Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 608585..609384 | Replicon | chromosome |
| Accession | NZ_HG994851 | ||
| Organism | Escherichia coli isolate 127 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | Q8FDB4 |
| Locus tag | LLO82_RS02975 | Protein ID | WP_000347252.1 |
| Coordinates | 608585..609049 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | LLO82_RS02980 | Protein ID | WP_001296435.1 |
| Coordinates | 609049..609384 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLO82_RS02945 (603586) | 603586..604020 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| LLO82_RS02950 (604038) | 604038..604916 | - | 879 | WP_001298314.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| LLO82_RS02955 (604906) | 604906..605685 | - | 780 | WP_227431555.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| LLO82_RS02960 (605696) | 605696..606169 | - | 474 | WP_001298322.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| LLO82_RS02965 (606192) | 606192..607472 | - | 1281 | WP_000681930.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| LLO82_RS02970 (607721) | 607721..608530 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| LLO82_RS02975 (608585) | 608585..609049 | - | 465 | WP_000347252.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| LLO82_RS02980 (609049) | 609049..609384 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| LLO82_RS02985 (609533) | 609533..611104 | - | 1572 | WP_001273939.1 | galactarate dehydratase | - |
| LLO82_RS02990 (611479) | 611479..612813 | + | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
| LLO82_RS02995 (612829) | 612829..613599 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17750.11 Da Isoelectric Point: 9.4947
>T285312 WP_000347252.1 NZ_HG994851:c609049-608585 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|