Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 188663..188885 | Replicon | chromosome |
Accession | NZ_HG994851 | ||
Organism | Escherichia coli isolate 127 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | LLO82_RS00890 | Protein ID | WP_001295224.1 |
Coordinates | 188778..188885 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 188663..188729 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LLO82_RS00870 | 184104..185006 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
LLO82_RS00875 | 185017..186000 | + | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
LLO82_RS00880 | 185997..187001 | + | 1005 | WP_000103577.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
LLO82_RS00885 | 187031..188302 | - | 1272 | WP_001298005.1 | aromatic amino acid transport family protein | - |
- | 188663..188729 | - | 67 | - | - | Antitoxin |
LLO82_RS00890 | 188778..188885 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
LLO82_RS00895 | 188972..190651 | - | 1680 | WP_000191565.1 | cellulose biosynthesis protein BcsG | - |
LLO82_RS00900 | 190648..190839 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
LLO82_RS00905 | 190836..192407 | - | 1572 | WP_001204945.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
LLO82_RS00910 | 192680..192868 | + | 189 | WP_001063314.1 | cellulose biosynthesis protein BcsR | - |
LLO82_RS00915 | 192880..193632 | + | 753 | WP_000279536.1 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T285311 WP_001295224.1 NZ_HG994851:188778-188885 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT285311 NZ_HG994851:c188729-188663 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|