Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 188663..188885 Replicon chromosome
Accession NZ_HG994851
Organism Escherichia coli isolate 127

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag LLO82_RS00890 Protein ID WP_001295224.1
Coordinates 188778..188885 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 188663..188729 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LLO82_RS00870 184104..185006 + 903 WP_000084677.1 dipeptide ABC transporter permease DppC -
LLO82_RS00875 185017..186000 + 984 WP_001196477.1 dipeptide ABC transporter ATP-binding protein -
LLO82_RS00880 185997..187001 + 1005 WP_000103577.1 dipeptide ABC transporter ATP-binding subunit DppF -
LLO82_RS00885 187031..188302 - 1272 WP_001298005.1 aromatic amino acid transport family protein -
- 188663..188729 - 67 - - Antitoxin
LLO82_RS00890 188778..188885 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
LLO82_RS00895 188972..190651 - 1680 WP_000191565.1 cellulose biosynthesis protein BcsG -
LLO82_RS00900 190648..190839 - 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
LLO82_RS00905 190836..192407 - 1572 WP_001204945.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
LLO82_RS00910 192680..192868 + 189 WP_001063314.1 cellulose biosynthesis protein BcsR -
LLO82_RS00915 192880..193632 + 753 WP_000279536.1 cellulose biosynthesis protein BcsQ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T285311 WP_001295224.1 NZ_HG994851:188778-188885 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT285311 NZ_HG994851:c188729-188663 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References