Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4970323..4970925 | Replicon | chromosome |
Accession | NZ_HG994850 | ||
Organism | Escherichia coli isolate 127 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | LLO83_RS23930 | Protein ID | WP_000897305.1 |
Coordinates | 4970614..4970925 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | LLO83_RS23925 | Protein ID | WP_000356397.1 |
Coordinates | 4970323..4970613 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LLO83_RS23905 (4966825) | 4966825..4967727 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
LLO83_RS23910 (4967724) | 4967724..4968359 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
LLO83_RS23915 (4968356) | 4968356..4969285 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
LLO83_RS23920 (4969500) | 4969500..4969718 | - | 219 | WP_001298592.1 | CopG family transcriptional regulator | - |
LLO83_RS23925 (4970323) | 4970323..4970613 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
LLO83_RS23930 (4970614) | 4970614..4970925 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
LLO83_RS23935 (4971154) | 4971154..4972062 | + | 909 | WP_001298596.1 | alpha/beta hydrolase | - |
LLO83_RS23940 (4972126) | 4972126..4973067 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
LLO83_RS23945 (4973112) | 4973112..4973549 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
LLO83_RS23950 (4973546) | 4973546..4974418 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
LLO83_RS23955 (4974412) | 4974412..4975011 | - | 600 | WP_001298594.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12172.16 Da Isoelectric Point: 9.7791
>T285310 WP_000897305.1 NZ_HG994850:c4970925-4970614 [Escherichia coli]
ILFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
ILFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|