Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 4361475..4361887 | Replicon | chromosome |
Accession | NZ_HG994850 | ||
Organism | Escherichia coli isolate 127 |
Toxin (Protein)
Gene name | symE | Uniprot ID | S1NWQ7 |
Locus tag | LLO83_RS21095 | Protein ID | WP_000132614.1 |
Coordinates | 4361546..4361887 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 4361475..4361551 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LLO83_RS21085 (4358150) | 4358150..4359619 | + | 1470 | WP_001540814.1 | type I restriction-modification system subunit M | - |
LLO83_RS21090 (4359619) | 4359619..4361325 | + | 1707 | WP_001100194.1 | restriction endonuclease subunit S | - |
- (4361475) | 4361475..4361551 | - | 77 | NuclAT_6 | - | Antitoxin |
- (4361475) | 4361475..4361551 | - | 77 | NuclAT_6 | - | Antitoxin |
- (4361475) | 4361475..4361551 | - | 77 | NuclAT_6 | - | Antitoxin |
- (4361475) | 4361475..4361551 | - | 77 | NuclAT_6 | - | Antitoxin |
- (4361475) | 4361475..4361551 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4361475) | 4361475..4361551 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4361475) | 4361475..4361551 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4361475) | 4361475..4361551 | - | 77 | NuclAT_7 | - | Antitoxin |
LLO83_RS21095 (4361546) | 4361546..4361887 | + | 342 | WP_000132614.1 | endoribonuclease SymE | Toxin |
LLO83_RS21100 (4361934) | 4361934..4363097 | - | 1164 | WP_072002093.1 | DUF1524 domain-containing protein | - |
LLO83_RS21105 (4363145) | 4363145..4364027 | - | 883 | Protein_4136 | DUF262 domain-containing protein | - |
LLO83_RS21115 (4364217) | 4364217..4364294 | + | 78 | Protein_4137 | hypothetical protein | - |
LLO83_RS21120 (4364433) | 4364433..4365353 | - | 921 | WP_000181195.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
LLO83_RS21125 (4365538) | 4365538..4366818 | + | 1281 | WP_001298033.1 | DUF445 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | cheD | 4345354..4364090 | 18736 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12266.07 Da Isoelectric Point: 8.4982
>T285304 WP_000132614.1 NZ_HG994850:4361546-4361887 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT285304 NZ_HG994850:c4361551-4361475 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|