Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3945989..3946683 | Replicon | chromosome |
Accession | NZ_HG994850 | ||
Organism | Escherichia coli isolate 127 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | LLO83_RS19005 | Protein ID | WP_001263500.1 |
Coordinates | 3945989..3946387 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | LLO83_RS19010 | Protein ID | WP_000554758.1 |
Coordinates | 3946390..3946683 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LLO83_RS18980 (3941354) | 3941354..3941812 | - | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
LLO83_RS18985 (3942073) | 3942073..3943530 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
LLO83_RS18990 (3943587) | 3943587..3944201 | - | 615 | WP_000602124.1 | peptide chain release factor H | - |
LLO83_RS18995 (3944198) | 3944198..3945337 | - | 1140 | WP_000521561.1 | RNA ligase RtcB family protein | - |
LLO83_RS19000 (3945527) | 3945527..3945979 | - | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
LLO83_RS19005 (3945989) | 3945989..3946387 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
LLO83_RS19010 (3946390) | 3946390..3946683 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
LLO83_RS19015 (3946735) | 3946735..3947790 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
LLO83_RS19020 (3947861) | 3947861..3948646 | - | 786 | WP_000207578.1 | putative lateral flagellar export/assembly protein LafU | - |
LLO83_RS19025 (3948618) | 3948618..3950330 | + | 1713 | Protein_3729 | flagellar biosynthesis protein FlhA | - |
LLO83_RS19030 (3950650) | 3950650..3951147 | - | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | blaOXA-48 | gmhA/lpcA | 3945989..3988215 | 42226 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T285301 WP_001263500.1 NZ_HG994850:c3946387-3945989 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|