Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3642913..3643592 | Replicon | chromosome |
| Accession | NZ_HG994850 | ||
| Organism | Escherichia coli isolate 127 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | LLO83_RS17590 | Protein ID | WP_000057523.1 |
| Coordinates | 3643290..3643592 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | LLO83_RS17585 | Protein ID | WP_000806442.1 |
| Coordinates | 3642913..3643254 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLO83_RS17575 (3639157) | 3639157..3640089 | - | 933 | WP_000883025.1 | glutaminase A | - |
| LLO83_RS17580 (3640351) | 3640351..3642855 | + | 2505 | WP_000083943.1 | copper-exporting P-type ATPase CopA | - |
| LLO83_RS17585 (3642913) | 3642913..3643254 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| LLO83_RS17590 (3643290) | 3643290..3643592 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LLO83_RS17595 (3643725) | 3643725..3644519 | + | 795 | WP_000365148.1 | TraB/GumN family protein | - |
| LLO83_RS17600 (3644723) | 3644723..3645202 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| LLO83_RS17605 (3645226) | 3645226..3646026 | + | 801 | WP_000439798.1 | hypothetical protein | - |
| LLO83_RS17610 (3646023) | 3646023..3646526 | + | 504 | WP_000667000.1 | hypothetical protein | - |
| LLO83_RS17615 (3646564) | 3646564..3648216 | - | 1653 | WP_000771760.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T285298 WP_000057523.1 NZ_HG994850:c3643592-3643290 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|