Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 608586..609385 | Replicon | chromosome |
| Accession | NZ_HG994850 | ||
| Organism | Escherichia coli isolate 127 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | Q8FDB4 |
| Locus tag | LLO83_RS02970 | Protein ID | WP_000347252.1 |
| Coordinates | 608586..609050 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | LLO83_RS02975 | Protein ID | WP_001296435.1 |
| Coordinates | 609050..609385 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLO83_RS02940 (603587) | 603587..604021 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| LLO83_RS02945 (604039) | 604039..604917 | - | 879 | WP_001298314.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| LLO83_RS02950 (604907) | 604907..605686 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| LLO83_RS02955 (605697) | 605697..606170 | - | 474 | WP_001298322.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| LLO83_RS02960 (606193) | 606193..607473 | - | 1281 | WP_000681930.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| LLO83_RS02965 (607722) | 607722..608531 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| LLO83_RS02970 (608586) | 608586..609050 | - | 465 | WP_000347252.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| LLO83_RS02975 (609050) | 609050..609385 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| LLO83_RS02980 (609534) | 609534..611105 | - | 1572 | WP_001273939.1 | galactarate dehydratase | - |
| LLO83_RS02985 (611480) | 611480..612814 | + | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
| LLO83_RS02990 (612830) | 612830..613600 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17750.11 Da Isoelectric Point: 9.4947
>T285284 WP_000347252.1 NZ_HG994850:c609050-608586 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|