Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-MqsA
Location 1687080..1687713 Replicon chromosome
Accession NZ_HG992751
Organism Vibrio sp. B1FIG11 isolate LMG10946-nano

Toxin (Protein)


Gene name higB Uniprot ID A0A347UQS4
Locus tag KHO06_RS07870 Protein ID WP_012600340.1
Coordinates 1687080..1687412 (+) Length 111 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag KHO06_RS07875 Protein ID WP_017049537.1
Coordinates 1687399..1687713 (+) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KHO06_RS07825 1682147..1682236 + 90 WP_079725283.1 DUF3265 domain-containing protein -
KHO06_RS07830 (ACOMICROBIO_LMKGKHOH_02186) 1682410..1682796 + 387 WP_212582362.1 hypothetical protein -
KHO06_RS07835 1682820..1682936 + 117 WP_244858401.1 DUF3265 domain-containing protein -
KHO06_RS07840 1682900..1683394 + 495 WP_212582489.1 hypothetical protein -
KHO06_RS07845 (ACOMICROBIO_LMKGKHOH_02187) 1683561..1684289 + 729 WP_212582364.1 DUF5677 domain-containing protein -
KHO06_RS07850 1684304..1684396 + 93 WP_212582365.1 DUF3265 domain-containing protein -
KHO06_RS07855 (ACOMICROBIO_LMKGKHOH_02188) 1684425..1684952 + 528 WP_045374755.1 CbrC family protein -
KHO06_RS07860 1684973..1685065 + 93 WP_005445734.1 DUF3265 domain-containing protein -
KHO06_RS26465 1685484..1685613 + 130 Protein_1527 DUF3265 domain-containing protein -
KHO06_RS07865 (ACOMICROBIO_LMKGKHOH_02189) 1685646..1686860 + 1215 WP_212582366.1 DUF3644 domain-containing protein -
KHO06_RS07870 (ACOMICROBIO_LMKGKHOH_02190) 1687080..1687412 + 333 WP_012600340.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
KHO06_RS07875 (ACOMICROBIO_LOCUS1126) 1687399..1687713 + 315 WP_017049537.1 DNA-binding transcriptional regulator Antitoxin
KHO06_RS07880 1687728..1687820 + 93 WP_074050554.1 DUF3265 domain-containing protein -
KHO06_RS07885 (ACOMICROBIO_LMKGKHOH_02192) 1687848..1688375 + 528 WP_212582367.1 hypothetical protein -
KHO06_RS07890 (ACOMICROBIO_LMKGKHOH_02193) 1688544..1688945 + 402 WP_212582368.1 hypothetical protein -
KHO06_RS07895 1688963..1689052 + 90 WP_072609598.1 DUF3265 domain-containing protein -
KHO06_RS07900 (ACOMICROBIO_LOCUS1127) 1689080..1689892 + 813 WP_244858388.1 nucleotide-binding protein -
KHO06_RS07905 1689920..1690012 + 93 WP_130361595.1 DUF3265 domain-containing protein -
KHO06_RS07910 (ACOMICROBIO_LMKGKHOH_02195) 1690059..1690478 + 420 WP_212582369.1 hypothetical protein -
KHO06_RS07915 1690500..1690592 + 93 WP_140288197.1 DUF3265 domain-containing protein -
KHO06_RS07920 (ACOMICROBIO_LMKGKHOH_02196) 1691762..1692256 - 495 WP_212582370.1 hypothetical protein -
KHO06_RS07925 1692378..1692467 + 90 WP_079856435.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1634562..1733951 99389
- inside Integron - - 1632809..1727869 95060


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(4-104)

Antitoxin

Antitoxin MqsA/HigA-2

(24-101)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 12906.76 Da        Isoelectric Point: 10.0960

>T285277 WP_012600340.1 NZ_HG992751:1687080-1687412 [Vibrio sp. B1FIG11]
MKSVFVESTIFEKYRNEYLSDDEFRLFQAELMSNPKQGDVIQGTGGLRKIRVASKGKGKRGGSRVIYYFLDEKRRFYLLT
IYGKNEMSDLTADQKKQLKAFMEAWRNEQS

Download         Length: 333 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 11704.17 Da        Isoelectric Point: 6.3290

>AT285277 WP_017049537.1 NZ_HG992751:1687399-1687713 [Vibrio sp. B1FIG11]
MSNRDLFAELSSALVEAKEHSEGKLTLKTHQVNDISELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSAP
NGQAVTLLKLVQRHPETLSHIAEL

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A347UQS4

Antitoxin

Source ID Structure

References