Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5144349..5144938 | Replicon | chromosome |
Accession | NZ_HG992342 | ||
Organism | Xanthomonas arboricola pv. corylina strain CFBP 6600 isolate K100-1 |
Toxin (Protein)
Gene name | graT | Uniprot ID | A0A2N7V9W3 |
Locus tag | P3C55_RS22135 | Protein ID | WP_016902142.1 |
Coordinates | 5144657..5144938 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | P3C55_RS22130 | Protein ID | WP_026064232.1 |
Coordinates | 5144349..5144639 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3C55_RS22100 | 5140474..5141055 | + | 582 | WP_275544325.1 | ParA family protein | - |
P3C55_RS22105 (CFBP6600_44090) | 5141069..5142031 | - | 963 | WP_070689987.1 | IS1595 family transposase | - |
P3C55_RS22110 | 5142142..5142654 | + | 513 | WP_275544326.1 | hypothetical protein | - |
P3C55_RS22115 (CFBP6600_44100) | 5142669..5143316 | + | 648 | WP_104536557.1 | RelA/SpoT domain-containing protein | - |
P3C55_RS22120 (CFBP6600_44110) | 5143474..5143806 | + | 333 | WP_026064233.1 | hypothetical protein | - |
P3C55_RS22125 | 5143956..5144158 | + | 203 | Protein_4328 | hypothetical protein | - |
P3C55_RS22130 (CFBP6600_44130) | 5144349..5144639 | - | 291 | WP_026064232.1 | HigA family addiction module antitoxin | Antitoxin |
P3C55_RS22135 (CFBP6600_44140) | 5144657..5144938 | - | 282 | WP_016902142.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P3C55_RS22140 (CFBP6600_44150) | 5145078..5147204 | - | 2127 | WP_104613293.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11064.75 Da Isoelectric Point: 9.7972
>T285268 WP_016902142.1 NZ_HG992342:c5144938-5144657 [Xanthomonas arboricola pv. corylina]
MIRSFVDKEAEKIWMGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQWRICFRWM
EGDVAEVEIVDYH
MIRSFVDKEAEKIWMGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQWRICFRWM
EGDVAEVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|