Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5014980..5015569 | Replicon | chromosome |
| Accession | NZ_HG992341 | ||
| Organism | Xanthomonas arboricola pv. corylina strain CFBP 1159 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | A0A2N7V9W3 |
| Locus tag | P3C48_RS21320 | Protein ID | WP_016902142.1 |
| Coordinates | 5015288..5015569 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | P3C48_RS21315 | Protein ID | WP_026064232.1 |
| Coordinates | 5014980..5015270 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3C48_RS21290 (CFBP1159_42260) | 5010611..5011432 | + | 822 | WP_026064234.1 | restriction endonuclease | - |
| P3C48_RS21295 (CFBP1159_42270) | 5011771..5012622 | + | 852 | WP_146091500.1 | hypothetical protein | - |
| P3C48_RS21300 | 5013411..5013935 | - | 525 | WP_104613292.1 | hypothetical protein | - |
| P3C48_RS21305 (CFBP1159_42280) | 5014105..5014437 | + | 333 | WP_026064233.1 | hypothetical protein | - |
| P3C48_RS21310 | 5014587..5014789 | + | 203 | Protein_4166 | hypothetical protein | - |
| P3C48_RS21315 (CFBP1159_42300) | 5014980..5015270 | - | 291 | WP_026064232.1 | HigA family addiction module antitoxin | Antitoxin |
| P3C48_RS21320 (CFBP1159_42310) | 5015288..5015569 | - | 282 | WP_016902142.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P3C48_RS21325 (CFBP1159_42320) | 5015709..5017835 | - | 2127 | WP_275548228.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11064.75 Da Isoelectric Point: 9.7972
>T285265 WP_016902142.1 NZ_HG992341:c5015569-5015288 [Xanthomonas arboricola pv. corylina]
MIRSFVDKEAEKIWMGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQWRICFRWM
EGDVAEVEIVDYH
MIRSFVDKEAEKIWMGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQWRICFRWM
EGDVAEVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|