Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 476496..477095 | Replicon | chromosome |
| Accession | NZ_HG969192 | ||
| Organism | Bartonella tribocorum strain BM1374166 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A5B9CYQ5 |
| Locus tag | BM1374166_RS01935 | Protein ID | WP_012230946.1 |
| Coordinates | 476496..476777 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | BM1374166_RS01940 | Protein ID | WP_012230948.1 |
| Coordinates | 476796..477095 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BM1374166_RS01905 | 471999..472406 | + | 408 | WP_012230938.1 | hypothetical protein | - |
| BM1374166_RS01910 | 472483..473871 | + | 1389 | WP_012230940.1 | hypothetical protein | - |
| BM1374166_RS01915 | 473868..474281 | + | 414 | WP_012230942.1 | hypothetical protein | - |
| BM1374166_RS01920 | 474358..475281 | + | 924 | WP_038473276.1 | hypothetical protein | - |
| BM1374166_RS01925 | 475343..475804 | + | 462 | WP_081458175.1 | hypothetical protein | - |
| BM1374166_RS01930 | 475801..476214 | + | 414 | WP_012230944.1 | hypothetical protein | - |
| BM1374166_RS01935 | 476496..476777 | + | 282 | WP_012230946.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| BM1374166_RS01940 | 476796..477095 | + | 300 | WP_012230948.1 | HigA family addiction module antidote protein | Antitoxin |
| BM1374166_RS01945 | 477153..478190 | - | 1038 | WP_012230950.1 | tyrosine-type recombinase/integrase | - |
| BM1374166_RS01950 | 478193..478441 | - | 249 | WP_012230952.1 | hypothetical protein | - |
| BM1374166_RS01955 | 478553..479176 | - | 624 | WP_012230954.1 | YqaJ viral recombinase family protein | - |
| BM1374166_RS01960 | 479178..479984 | - | 807 | WP_038473282.1 | ERF family protein | - |
| BM1374166_RS01965 | 480058..480600 | - | 543 | WP_012230958.1 | hypothetical protein | - |
| BM1374166_RS01970 | 480594..481085 | - | 492 | WP_012230960.1 | hypothetical protein | - |
| BM1374166_RS01975 | 481089..481703 | - | 615 | WP_012230962.1 | hypothetical protein | - |
| BM1374166_RS01980 | 481715..482032 | - | 318 | WP_012230964.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10675.46 Da Isoelectric Point: 10.2972
>T285246 WP_012230946.1 NZ_HG969192:476496-476777 [Bartonella tribocorum]
MAIVSFKHKGLKLFYTTGSTKAIRPDHVKKLRVILTALTSATTPDMLRAPAFKMHPLKGELTGYYSIWVNGNWRVTFRFI
GTDVELVDYQDYH
MAIVSFKHKGLKLFYTTGSTKAIRPDHVKKLRVILTALTSATTPDMLRAPAFKMHPLKGELTGYYSIWVNGNWRVTFRFI
GTDVELVDYQDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|