Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 398046..398673 Replicon chromosome
Accession NZ_HG969192
Organism Bartonella tribocorum strain BM1374166

Toxin (Protein)


Gene name graT Uniprot ID A9INI4
Locus tag BM1374166_RS01525 Protein ID WP_012230802.1
Coordinates 398046..398360 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name graA Uniprot ID -
Locus tag BM1374166_RS01530 Protein ID WP_012230805.1
Coordinates 398377..398673 (+) Length 99 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BM1374166_RS01500 394536..395642 - 1107 WP_012230791.1 hypothetical protein -
BM1374166_RS01505 395642..396469 - 828 WP_012230798.1 baseplate J/gp47 family protein -
BM1374166_RS01510 396466..396807 - 342 WP_038473244.1 GPW/gp25 family protein -
BM1374166_RS01515 396804..397469 - 666 WP_012230800.1 phage baseplate assembly protein V -
BM1374166_RS01520 397450..397992 - 543 WP_012230801.1 hypothetical protein -
BM1374166_RS01525 398046..398360 + 315 WP_012230802.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
BM1374166_RS01530 398377..398673 + 297 WP_012230805.1 HigA family addiction module antidote protein Antitoxin
BM1374166_RS01535 398720..398998 - 279 WP_012230806.1 hypothetical protein -
BM1374166_RS13095 398995..399317 - 323 Protein_292 phage antirepressor KilAC domain-containing protein -
BM1374166_RS13100 399404..399729 - 326 Protein_293 Rha family transcriptional regulator -
BM1374166_RS01550 400110..401195 + 1086 WP_012230810.1 hypothetical protein -
BM1374166_RS01555 401199..401576 - 378 Protein_295 hypothetical protein -
BM1374166_RS01560 401578..402654 - 1077 WP_012230813.1 major capsid protein -
BM1374166_RS01565 402667..403035 - 369 WP_012230814.1 head decoration protein -
BM1374166_RS01570 403032..403376 - 345 WP_038474435.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 373809..426195 52386


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(12-104)

Antitoxin

Toxin-antitoxin system, antidote protein, HigA

(5-94)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 12140.05 Da        Isoelectric Point: 10.0702

>T285244 WP_012230802.1 NZ_HG969192:398046-398360 [Bartonella tribocorum]
MIHKRTHRGDLVIESFADKRCKDLLEGKTPKGFPATLVRIAQRKLFMLDKAVDLKDLRSPPGNHLEALKGERKGQYSIRI
NNQFRLCFEWRTNGAYEVEIVDYH

Download         Length: 315 bp

Antitoxin


Download         Length: 99 a.a.        Molecular weight: 11294.96 Da        Isoelectric Point: 5.7188

>AT285244 WP_012230805.1 NZ_HG969192:398377-398673 [Bartonella tribocorum]
MKNYIAIHPGEILREEYLKEYALSAYALAKALNVPRTRIERIIAENSPITPDTALRLASFFDTTAEFWLNMQAAYDVHIL
QAEKADEFAKINKFECRT

Download         Length: 297 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A9INI4

Antitoxin

Source ID Structure

References