Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 382678..383305 | Replicon | chromosome |
Accession | NZ_HG969191 | ||
Organism | Bartonella henselae strain BM1374165 |
Toxin (Protein)
Gene name | higB | Uniprot ID | X5MEM9 |
Locus tag | BM1374165_RS01560 | Protein ID | WP_038487056.1 |
Coordinates | 382678..382992 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | BM1374165_RS01565 | Protein ID | WP_034454130.1 |
Coordinates | 383009..383305 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BM1374165_RS01540 | 378314..379858 | - | 1545 | WP_038487050.1 | phage portal protein | - |
BM1374165_RS01545 | 379858..380106 | - | 249 | WP_038487052.1 | phage related protein | - |
BM1374165_RS01550 | 380110..382041 | - | 1932 | WP_038487054.1 | phage terminase large subunit family protein | - |
BM1374165_RS01555 | 382034..382615 | - | 582 | WP_038488823.1 | hypothetical protein | - |
BM1374165_RS01560 | 382678..382992 | + | 315 | WP_038487056.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
BM1374165_RS01565 | 383009..383305 | + | 297 | WP_034454130.1 | HigA family addiction module antidote protein | Antitoxin |
BM1374165_RS01570 | 383714..383977 | + | 264 | WP_038487057.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
BM1374165_RS01575 | 383964..384245 | + | 282 | WP_011180281.1 | type II toxin-antitoxin system YafQ family toxin | - |
BM1374165_RS01580 | 384288..384566 | - | 279 | WP_038487059.1 | hypothetical protein | - |
BM1374165_RS01585 | 384563..385321 | - | 759 | WP_038487061.1 | antA/AntB antirepressor family protein | - |
BM1374165_RS01590 | 385616..386179 | - | 564 | Protein_300 | antA/AntB antirepressor family protein | - |
BM1374165_RS01595 | 386757..387347 | - | 591 | WP_038487063.1 | antA/AntB antirepressor family protein | - |
BM1374165_RS01600 | 387675..388253 | - | 579 | WP_038487065.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 361130..408510 | 47380 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12135.97 Da Isoelectric Point: 9.0878
>T285229 WP_038487056.1 NZ_HG969191:382678-382992 [Bartonella henselae]
MIHKRTNEGDLVIESFADKRCKDLLEGNPPKGFPTTLVRIVQRKLFMLDKAVDLKDLRSPPGNRLDALKGERKGQYSIRI
NDQFRICFEWRSNGAYEVEIIDYH
MIHKRTNEGDLVIESFADKRCKDLLEGNPPKGFPTTLVRIVQRKLFMLDKAVDLKDLRSPPGNRLDALKGERKGQYSIRI
NDQFRICFEWRSNGAYEVEIIDYH
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|