Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 406071..406698 | Replicon | chromosome |
Accession | NZ_HG965802 | ||
Organism | Bartonella henselae strain BM1374163 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0H3M2H0 |
Locus tag | PRJBM_RS01655 | Protein ID | WP_011180277.1 |
Coordinates | 406071..406385 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | PRJBM_RS01660 | Protein ID | WP_011180278.1 |
Coordinates | 406402..406698 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PRJBM_RS01635 | 401698..403254 | - | 1557 | WP_011180273.1 | phage portal protein | - |
PRJBM_RS01640 | 403254..403502 | - | 249 | WP_011180274.1 | hypothetical protein | - |
PRJBM_RS01645 | 403506..405434 | - | 1929 | WP_011180275.1 | phage terminase large subunit family protein | - |
PRJBM_RS01650 | 405427..406008 | - | 582 | WP_011180276.1 | hypothetical protein | - |
PRJBM_RS01655 | 406071..406385 | + | 315 | WP_011180277.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PRJBM_RS01660 | 406402..406698 | + | 297 | WP_011180278.1 | HigA family addiction module antidote protein | Antitoxin |
PRJBM_RS01665 | 407108..407371 | + | 264 | WP_011180280.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
PRJBM_RS01670 | 407358..407639 | + | 282 | WP_011180281.1 | type II toxin-antitoxin system YafQ family toxin | - |
PRJBM_RS01675 | 407682..407960 | - | 279 | WP_011180242.1 | hypothetical protein | - |
PRJBM_RS01680 | 407957..408715 | - | 759 | WP_011180282.1 | phage antirepressor Ant | - |
PRJBM_RS01685 | 408775..409290 | - | 516 | WP_011180283.1 | phage antirepressor Ant | - |
PRJBM_RS01690 | 409583..410146 | - | 564 | Protein_328 | antA/AntB antirepressor family protein | - |
PRJBM_RS01695 | 410178..410720 | - | 543 | WP_011180285.1 | phage antirepressor Ant | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 362344..432004 | 69660 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12135.97 Da Isoelectric Point: 9.0878
>T285220 WP_011180277.1 NZ_HG965802:406071-406385 [Bartonella henselae]
MIHKRTNEGDLVIESFADKRCKDLLEGNPPKGFPTTLVRIVQRKLFMLDKAVDLKDLRSPPGNRLEALKGERKGQYSIRI
NDQFRICFEWRSNGAYEVEIVDYH
MIHKRTNEGDLVIESFADKRCKDLLEGNPPKGFPTTLVRIVQRKLFMLDKAVDLKDLRSPPGNRLEALKGERKGQYSIRI
NDQFRICFEWRSNGAYEVEIVDYH
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|