Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4451911..4452513 | Replicon | chromosome |
| Accession | NZ_HG941718 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain EC958 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | EC958_RS22340 | Protein ID | WP_000897302.1 |
| Coordinates | 4451911..4452222 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EC958_RS22345 | Protein ID | WP_000356397.1 |
| Coordinates | 4452223..4452513 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC958_RS22315 | 4447825..4448424 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
| EC958_RS22320 | 4448418..4449290 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| EC958_RS22325 | 4449287..4449724 | + | 438 | WP_000560981.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| EC958_RS22330 | 4449769..4450710 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| EC958_RS22335 | 4450774..4451682 | - | 909 | WP_001296611.1 | alpha/beta hydrolase | - |
| EC958_RS22340 | 4451911..4452222 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| EC958_RS22345 | 4452223..4452513 | + | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
| EC958_RS22355 | 4452872..4453150 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| EC958_RS22360 | 4453547..4453765 | + | 219 | WP_001251293.1 | ribbon-helix-helix domain-containing protein | - |
| EC958_RS22365 | 4453950..4454399 | - | 450 | WP_032140890.1 | hypothetical protein | - |
| EC958_RS22370 | 4454715..4455563 | - | 849 | WP_001038650.1 | hypothetical protein | - |
| EC958_RS22375 | 4455853..4456095 | + | 243 | WP_001068514.1 | ribbon-helix-helix domain-containing protein | - |
| EC958_RS22380 | 4456277..4457206 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T285207 WP_000897302.1 NZ_HG941718:4451911-4452222 [Escherichia coli O25b:H4-ST131]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|