Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 3577014..3577813 | Replicon | chromosome |
| Accession | NZ_HG941718 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain EC958 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | S1NYM6 |
| Locus tag | EC958_RS17980 | Protein ID | WP_000347251.1 |
| Coordinates | 3577349..3577813 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | EC958_RS17975 | Protein ID | WP_001296435.1 |
| Coordinates | 3577014..3577349 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC958_RS17960 | 3572799..3573569 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| EC958_RS17965 | 3573585..3574919 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| EC958_RS17970 | 3575294..3576865 | + | 1572 | WP_001273763.1 | galactarate dehydratase | - |
| EC958_RS17975 | 3577014..3577349 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| EC958_RS17980 | 3577349..3577813 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| EC958_RS17985 | 3577868..3578677 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| EC958_RS17990 | 3578926..3580206 | + | 1281 | WP_000681950.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| EC958_RS17995 | 3580229..3580702 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| EC958_RS18000 | 3580713..3581492 | + | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
| EC958_RS18005 | 3581482..3582360 | + | 879 | WP_001295548.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| EC958_RS18010 | 3582378..3582812 | + | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T285204 WP_000347251.1 NZ_HG941718:3577349-3577813 [Escherichia coli O25b:H4-ST131]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Download Length: 112 a.a. Molecular weight: 12321.92 Da Isoelectric Point: 4.5392
>AT285204 WP_001296435.1 NZ_HG941718:3577014-3577349 [Escherichia coli O25b:H4-ST131]
MPANARSNAVLTTESKVTIRGQTTIPAPVREALKLKPGLDSIHYEILPGGQVFMCRLGDEQEDHTMNAFLRFLDADIQNN
PQKTRPFDIQQGKKLVAGMDVNIDDEIGDDE
MPANARSNAVLTTESKVTIRGQTTIPAPVREALKLKPGLDSIHYEILPGGQVFMCRLGDEQEDHTMNAFLRFLDADIQNN
PQKTRPFDIQQGKKLVAGMDVNIDDEIGDDE
Download Length: 336 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJ20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1PPV5 |