Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
Location | 2289134..2289636 | Replicon | chromosome |
Accession | NZ_HG941718 | ||
Organism | Escherichia coli O25b:H4-ST131 strain EC958 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | E2QNP2 |
Locus tag | EC958_RS11895 | Protein ID | WP_000767819.1 |
Coordinates | 2289134..2289388 (-) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | E2QNP3 |
Locus tag | EC958_RS11900 | Protein ID | WP_001259253.1 |
Coordinates | 2289385..2289636 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC958_RS11870 | 2284952..2285410 | - | 459 | WP_001531805.1 | IS200/IS605-like element IS200C family transposase | - |
EC958_RS11880 | 2285627..2286985 | - | 1359 | WP_000019194.1 | putrescine/proton symporter PlaP | - |
EC958_RS29280 | 2286975..2287037 | - | 63 | WP_010723108.1 | membrane protein YoeI | - |
EC958_RS11885 | 2287252..2288181 | - | 930 | WP_000803366.1 | LysR family transcriptional regulator | - |
EC958_RS11890 | 2288227..2289051 | - | 825 | WP_000754737.1 | SDR family oxidoreductase | - |
EC958_RS11895 | 2289134..2289388 | - | 255 | WP_000767819.1 | type II toxin-antitoxin system mRNA interferase toxin YoeB | Toxin |
EC958_RS11900 | 2289385..2289636 | - | 252 | WP_001259253.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
EC958_RS27260 | 2289919..2289969 | + | 51 | WP_001364200.1 | his operon leader peptide | - |
EC958_RS11905 | 2290115..2291014 | + | 900 | WP_000131782.1 | ATP phosphoribosyltransferase | - |
EC958_RS11910 | 2291020..2292324 | + | 1305 | WP_001296211.1 | histidinol dehydrogenase | - |
EC958_RS11915 | 2292321..2293391 | + | 1071 | WP_000108967.1 | histidinol-phosphate transaminase | - |
EC958_RS11920 | 2293391..2294458 | + | 1068 | WP_000080057.1 | bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2284952..2285410 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10110.53 Da Isoelectric Point: 7.2749
>T285199 WP_000767819.1 NZ_HG941718:c2289388-2289134 [Escherichia coli O25b:H4-ST131]
VKLIWSEESWDDYLYWQEADKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHLLVYAVTDDSLLIAAC
RYHY
VKLIWSEESWDDYLYWQEADKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHLLVYAVTDDSLLIAAC
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|