Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 538457..539136 | Replicon | chromosome |
Accession | NZ_HG941718 | ||
Organism | Escherichia coli O25b:H4-ST131 strain EC958 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | EC958_RS02530 | Protein ID | WP_000057523.1 |
Coordinates | 538457..538759 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | EC958_RS02535 | Protein ID | WP_000806442.1 |
Coordinates | 538795..539136 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC958_RS02505 | 533833..535485 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
EC958_RS02510 | 535523..536026 | - | 504 | WP_000667000.1 | hypothetical protein | - |
EC958_RS02515 | 536023..536823 | - | 801 | WP_000439798.1 | hypothetical protein | - |
EC958_RS02520 | 536847..537326 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
EC958_RS02525 | 537530..538324 | - | 795 | WP_000365147.1 | TraB/GumN family protein | - |
EC958_RS02530 | 538457..538759 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EC958_RS02535 | 538795..539136 | + | 342 | WP_000806442.1 | HigA family addiction module antidote protein | Antitoxin |
EC958_RS02540 | 539194..541698 | - | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
EC958_RS02545 | 541960..542892 | + | 933 | WP_000883041.1 | glutaminase A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T285188 WP_000057523.1 NZ_HG941718:538457-538759 [Escherichia coli O25b:H4-ST131]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 13171.10 Da Isoelectric Point: 5.7790
>AT285188 WP_000806442.1 NZ_HG941718:538795-539136 [Escherichia coli O25b:H4-ST131]
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|