Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
| Location | 1859237..1859750 | Replicon | chromosome |
| Accession | NZ_HG939456 | ||
| Organism | Streptococcus agalactiae COH1 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | Q8DX49 |
| Locus tag | GBSCOH1_RS09260 | Protein ID | WP_000481712.1 |
| Coordinates | 1859237..1859491 (-) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | Q8DX48 |
| Locus tag | GBSCOH1_RS09265 | Protein ID | WP_000387490.1 |
| Coordinates | 1859484..1859750 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GBSCOH1_RS09240 | 1855001..1857502 | - | 2502 | WP_000239414.1 | ATP-binding protein | - |
| GBSCOH1_RS09245 | 1857523..1857933 | - | 411 | WP_000390747.1 | conjugal transfer protein | - |
| GBSCOH1_RS09250 | 1857944..1858210 | - | 267 | WP_001055037.1 | hypothetical protein | - |
| GBSCOH1_RS09255 | 1858231..1859184 | - | 954 | WP_000565540.1 | conjugal transfer protein | - |
| GBSCOH1_RS09260 | 1859237..1859491 | - | 255 | WP_000481712.1 | Txe/YoeB family addiction module toxin | Toxin |
| GBSCOH1_RS09265 | 1859484..1859750 | - | 267 | WP_000387490.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| GBSCOH1_RS09270 | 1859895..1860368 | - | 474 | WP_000560386.1 | hypothetical protein | - |
| GBSCOH1_RS09275 | 1860376..1860858 | - | 483 | WP_000383283.1 | antirestriction protein ArdA | - |
| GBSCOH1_RS09280 | 1860911..1861183 | - | 273 | WP_000017154.1 | hypothetical protein | - |
| GBSCOH1_RS09285 | 1861318..1861887 | - | 570 | WP_000010056.1 | hypothetical protein | - |
| GBSCOH1_RS09290 | 1861890..1863239 | - | 1350 | WP_000491712.1 | AAA family ATPase | - |
| GBSCOH1_RS09295 | 1863436..1863735 | - | 300 | WP_000737133.1 | helix-turn-helix domain-containing protein | - |
| GBSCOH1_RS09300 | 1863719..1864096 | - | 378 | WP_000287186.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | cfa/cfb / cfa/cfb / groEL | 1848000..2014609 | 166609 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10445.87 Da Isoelectric Point: 6.7282
>T285184 WP_000481712.1 NZ_HG939456:c1859491-1859237 [Streptococcus agalactiae COH1]
MFNFTEEAWKDYVSWQQEDKKILKRINRLIEDIKRDPFEGIGKPEPLKYHYSGAWSRRITEEHRLIYMIEDGEIYFLSFR
DHYK
MFNFTEEAWKDYVSWQQEDKKILKRINRLIEDIKRDPFEGIGKPEPLKYHYSGAWSRRITEEHRLIYMIEDGEIYFLSFR
DHYK
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829IC12 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829I9V6 |