Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 2725241..2725817 | Replicon | chromosome |
Accession | NZ_HG938355 | ||
Organism | Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A068T9B4 |
Locus tag | RG1141_RS13765 | Protein ID | WP_038544643.1 |
Coordinates | 2725539..2725817 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | RG1141_RS13760 | Protein ID | WP_038588996.1 |
Coordinates | 2725241..2725525 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG1141_RS13730 | 2720535..2720921 | - | 387 | WP_038544630.1 | hypothetical protein | - |
RG1141_RS13735 | 2720963..2721985 | + | 1023 | WP_038544631.1 | RluA family pseudouridine synthase | - |
RG1141_RS13740 | 2722056..2722889 | + | 834 | WP_038544633.1 | AraC family transcriptional regulator | - |
RG1141_RS32480 | 2722983..2723144 | + | 162 | WP_173426754.1 | hypothetical protein | - |
RG1141_RS13745 | 2723251..2723556 | + | 306 | WP_038544635.1 | DUF1127 domain-containing protein | - |
RG1141_RS13750 | 2723805..2724707 | + | 903 | WP_038544637.1 | RNA polymerase sigma factor RpoH | - |
RG1141_RS13755 | 2724800..2725183 | + | 384 | WP_038544639.1 | ACT domain-containing protein | - |
RG1141_RS13760 | 2725241..2725525 | - | 285 | WP_038588996.1 | HigA family addiction module antidote protein | Antitoxin |
RG1141_RS13765 | 2725539..2725817 | - | 279 | WP_038544643.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
RG1141_RS13770 | 2725891..2728584 | - | 2694 | WP_038544644.1 | hypothetical protein | - |
RG1141_RS13775 | 2728644..2729942 | - | 1299 | WP_038544646.1 | adenylosuccinate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10256.55 Da Isoelectric Point: 6.2136
>T285165 WP_038544643.1 NZ_HG938355:c2725817-2725539 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MIKSWVNSSTRRFAEEGKSKFSGMDEEAAIELLAALHAASSLNDLSPLKSVGLHKLSGNRSGQWAMTINGPWRICFTFRD
GDAWDVEIVDYH
MIKSWVNSSTRRFAEEGKSKFSGMDEEAAIELLAALHAASSLNDLSPLKSVGLHKLSGNRSGQWAMTINGPWRICFTFRD
GDAWDVEIVDYH
Download Length: 279 bp
Antitoxin
Download Length: 95 a.a. Molecular weight: 10414.97 Da Isoelectric Point: 10.2943
>AT285165 WP_038588996.1 NZ_HG938355:c2725525-2725241 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MIAVHPGRILKRELTARSLSANQLALSLRLPSGRITDILNAKRGISPDTALRLARYFGNSARFWLDLQTAYELALAEREN
GERIAEEVKPAEAA
MIAVHPGRILKRELTARSLSANQLALSLRLPSGRITDILNAKRGISPDTALRLARYFGNSARFWLDLQTAYELALAEREN
GERIAEEVKPAEAA
Download Length: 285 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|