Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 2823096..2823672 | Replicon | chromosome |
Accession | NZ_HG938353 | ||
Organism | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A068STC6 |
Locus tag | RG540_RS14040 | Protein ID | WP_038588998.1 |
Coordinates | 2823394..2823672 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | RG540_RS14035 | Protein ID | WP_038588996.1 |
Coordinates | 2823096..2823380 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG540_RS14005 | 2818386..2818772 | - | 387 | WP_038588983.1 | hypothetical protein | - |
RG540_RS14010 | 2818826..2819848 | + | 1023 | WP_038588985.1 | RluA family pseudouridine synthase | - |
RG540_RS14015 | 2819919..2820752 | + | 834 | WP_038588988.1 | AraC family transcriptional regulator | - |
RG540_RS32855 | 2820845..2821006 | + | 162 | WP_167551674.1 | hypothetical protein | - |
RG540_RS14020 | 2821107..2821412 | + | 306 | WP_038588991.1 | DUF1127 domain-containing protein | - |
RG540_RS14025 | 2821662..2822564 | + | 903 | WP_038588993.1 | RNA polymerase sigma factor RpoH | - |
RG540_RS14030 | 2822655..2823038 | + | 384 | Protein_2804 | ACT domain-containing protein | - |
RG540_RS14035 | 2823096..2823380 | - | 285 | WP_038588996.1 | HigA family addiction module antidote protein | Antitoxin |
RG540_RS14040 | 2823394..2823672 | - | 279 | WP_038588998.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
RG540_RS14045 | 2823742..2826450 | - | 2709 | WP_038589002.1 | hypothetical protein | - |
RG540_RS14050 | 2826510..2827808 | - | 1299 | WP_038589004.1 | adenylosuccinate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10341.66 Da Isoelectric Point: 6.2136
>T285147 WP_038588998.1 NZ_HG938353:c2823672-2823394 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
MIKSWVNSSTRRFAEEGKSKFSGMNEEASIELLAALHAASSLNDLSPLKSVGLHKLSGNRLGQWAMTINGPWRICFTFRD
GDDWDVEIVDYH
MIKSWVNSSTRRFAEEGKSKFSGMNEEASIELLAALHAASSLNDLSPLKSVGLHKLSGNRLGQWAMTINGPWRICFTFRD
GDDWDVEIVDYH
Download Length: 279 bp
Antitoxin
Download Length: 95 a.a. Molecular weight: 10414.97 Da Isoelectric Point: 10.2943
>AT285147 WP_038588996.1 NZ_HG938353:c2823380-2823096 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
MIAVHPGRILKRELTARSLSANQLALSLRLPSGRITDILNAKRGISPDTALRLARYFGNSARFWLDLQTAYELALAEREN
GERIAEEVKPAEAA
MIAVHPGRILKRELTARSLSANQLALSLRLPSGRITDILNAKRGISPDTALRLARYFGNSARFWLDLQTAYELALAEREN
GERIAEEVKPAEAA
Download Length: 285 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|