Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 497762..498354 | Replicon | chromosome |
Accession | NZ_HG938353 | ||
Organism | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
Toxin (Protein)
Gene name | graT | Uniprot ID | A0A068SLQ8 |
Locus tag | RG540_RS02375 | Protein ID | WP_038584166.1 |
Coordinates | 497762..498046 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | RG540_RS02380 | Protein ID | WP_038584168.1 |
Coordinates | 498058..498354 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG540_RS02360 | 493833..494384 | + | 552 | WP_038540412.1 | LemA family protein | - |
RG540_RS02365 | 494472..495746 | + | 1275 | WP_157884641.1 | 3-phosphoshikimate 1-carboxyvinyltransferase | - |
RG540_RS02370 | 495792..497720 | + | 1929 | WP_038584165.1 | DUF2207 domain-containing protein | - |
RG540_RS02375 | 497762..498046 | + | 285 | WP_038584166.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
RG540_RS02380 | 498058..498354 | + | 297 | WP_038584168.1 | HigA family addiction module antidote protein | Antitoxin |
RG540_RS02385 | 498446..500662 | + | 2217 | WP_038584169.1 | glycine--tRNA ligase subunit beta | - |
RG540_RS02390 | 500744..502597 | - | 1854 | WP_038584170.1 | methyl-accepting chemotaxis protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10517.00 Da Isoelectric Point: 8.0882
>T285139 WP_038584166.1 NZ_HG938353:497762-498046 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
MAIRSYADAMTQSIASGKVPKGFPADLARRAVRKLTMIENAMELHDLRSPPGNHLEALKGDRAGQHSIRVNDQWRICFVW
TTAGAEQVEIVDYH
MAIRSYADAMTQSIASGKVPKGFPADLARRAVRKLTMIENAMELHDLRSPPGNHLEALKGDRAGQHSIRVNDQWRICFVW
TTAGAEQVEIVDYH
Download Length: 285 bp
Antitoxin
Download Length: 99 a.a. Molecular weight: 10924.62 Da Isoelectric Point: 6.7257
>AT285139 WP_038584168.1 NZ_HG938353:498058-498354 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
MASLLPPVHPGEILREEYLAPLHLSAGALAKKLNVPRTRIERLVAEQTSVTTDTALRLGRFFDTTPEFWMNLQTSYDLKV
ESTAKREEIAAIPVIHAA
MASLLPPVHPGEILREEYLAPLHLSAGALAKKLNVPRTRIERLVAEQTSVTTDTALRLGRFFDTTPEFWMNLQTSYDLKV
ESTAKREEIAAIPVIHAA
Download Length: 297 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|