Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1563246..1564048 | Replicon | chromosome |
| Accession | NZ_HG813242 | ||
| Organism | Staphylococcus epidermidis PM221 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | Q5HN83 |
| Locus tag | SEB_RS07300 | Protein ID | WP_002468490.1 |
| Coordinates | 1563246..1563425 (-) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | - |
| Locus tag | SEB_RS07305 | Protein ID | WP_038399510.1 |
| Coordinates | 1563449..1564048 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SEB_RS07280 | 1558639..1559772 | - | 1134 | WP_001829819.1 | GAF domain-containing sensor histidine kinase | - |
| SEB_RS07285 | 1559931..1560755 | + | 825 | WP_001829804.1 | RluA family pseudouridine synthase | - |
| SEB_RS07290 | 1561116..1562501 | - | 1386 | WP_001829862.1 | class II fumarate hydratase | - |
| SEB_RS07295 | 1562686..1563090 | - | 405 | WP_001829818.1 | hypothetical protein | - |
| SEB_RS07300 | 1563246..1563425 | - | 180 | WP_002468490.1 | hypothetical protein | Toxin |
| SEB_RS07305 | 1563449..1564048 | - | 600 | WP_038399510.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| SEB_RS07310 | 1564206..1564676 | - | 471 | WP_001829836.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| SEB_RS07315 | 1564673..1565803 | - | 1131 | WP_001829814.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| SEB_RS13320 | 1566013..1566168 | - | 156 | WP_001829854.1 | hypothetical protein | - |
| SEB_RS07325 | 1566665..1567387 | - | 723 | WP_001829838.1 | amino acid ABC transporter ATP-binding protein | - |
| SEB_RS07330 | 1567380..1568837 | - | 1458 | WP_002440300.1 | ABC transporter substrate-binding protein/permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 1566013..1566168 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6963.56 Da Isoelectric Point: 4.3016
>T285113 WP_002468490.1 NZ_HG813242:c1563425-1563246 [Staphylococcus epidermidis PM221]
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
Download Length: 180 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22723.69 Da Isoelectric Point: 5.1598
>AT285113 WP_038399510.1 NZ_HG813242:c1564048-1563449 [Staphylococcus epidermidis PM221]
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVEKHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVEKHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|