Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3544834..3545504 | Replicon | chromosome |
Accession | NZ_HG813240 | ||
Organism | Mycobacterium tuberculosis 49-02 |
Toxin (Protein)
Gene name | higB | Uniprot ID | O53332 |
Locus tag | MT49_RS16770 | Protein ID | WP_003899954.1 |
Coordinates | 3544834..3545178 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0THF6 |
Locus tag | MT49_RS16775 | Protein ID | WP_003899955.1 |
Coordinates | 3545175..3545504 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT49_RS16740 | 3540139..3540432 | + | 294 | WP_003416635.1 | hypothetical protein | - |
MT49_RS16745 | 3540720..3542009 | + | 1290 | WP_003416640.1 | ATP-binding protein | - |
MT49_RS16760 | 3543714..3544148 | - | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
MT49_RS16765 | 3544151..3544603 | - | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
MT49_RS16770 | 3544834..3545178 | + | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MT49_RS16775 | 3545175..3545504 | + | 330 | WP_003899955.1 | XRE family transcriptional regulator | Antitoxin |
MT49_RS16780 | 3546042..3546389 | + | 348 | WP_003899956.1 | DUF2384 domain-containing protein | - |
MT49_RS16785 | 3546386..3547006 | + | 621 | WP_003899957.1 | RES family NAD+ phosphorylase | - |
MT49_RS16790 | 3547166..3548431 | - | 1266 | WP_003902423.1 | hypothetical protein | - |
MT49_RS16795 | 3548599..3548808 | + | 210 | WP_003416778.1 | hypothetical protein | - |
MT49_RS16805 | 3549055..3550089 | - | 1035 | WP_003416786.1 | IS30 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T285108 WP_003899954.1 NZ_HG813240:3544834-3545178 [Mycobacterium tuberculosis 49-02]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Download Length: 110 a.a. Molecular weight: 11802.46 Da Isoelectric Point: 7.4051
>AT285108 WP_003899955.1 NZ_HG813240:3545175-3545504 [Mycobacterium tuberculosis 49-02]
MTMARNWRDIRADAVAQGRVDLQRAAVAREEMRDAVLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTEL
GTLQAYVAALGGHLRIVAEFGENTVELTA
MTMARNWRDIRADAVAQGRVDLQRAAVAREEMRDAVLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTEL
GTLQAYVAALGGHLRIVAEFGENTVELTA
Download Length: 330 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBK2 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6LTY | |
PDB | 6LTZ | |
AlphaFold DB | G0THF6 |