Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2258958..2259877 | Replicon | chromosome |
| Accession | NZ_HG813240 | ||
| Organism | Mycobacterium tuberculosis 49-02 | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | L7N4R2 |
| Locus tag | MT49_RS21360 | Protein ID | WP_003900449.1 |
| Coordinates | 2259272..2259877 (-) | Length | 202 a.a. |
Antitoxin (Protein)
| Gene name | HigA2 | Uniprot ID | L7N5K9 |
| Locus tag | MT49_RS10590 | Protein ID | WP_003410124.1 |
| Coordinates | 2258958..2259263 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MT49_RS10550 | 2254221..2254421 | + | 201 | Protein_2068 | hypothetical protein | - |
| MT49_RS10565 | 2255777..2256154 | + | 378 | Protein_2070 | hypothetical protein | - |
| MT49_RS10570 | 2256151..2257191 | + | 1041 | WP_003410103.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MT49_RS10575 | 2257433..2258152 | + | 720 | WP_003410108.1 | DUF433 domain-containing protein | - |
| MT49_RS10580 | 2258142..2258558 | + | 417 | WP_003410114.1 | hypothetical protein | - |
| MT49_RS10585 | 2258574..2258873 | - | 300 | WP_003410120.1 | hypothetical protein | - |
| MT49_RS10590 | 2258958..2259263 | - | 306 | WP_003410124.1 | XRE family transcriptional regulator | Antitoxin |
| MT49_RS21360 | 2259272..2259877 | - | 606 | WP_003900449.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| MT49_RS10600 | 2259902..2260261 | - | 360 | WP_003410131.1 | hypothetical protein | - |
| MT49_RS10605 | 2260421..2261098 | - | 678 | WP_003905725.1 | hypothetical protein | - |
| MT49_RS10610 | 2261050..2261286 | - | 237 | WP_003410133.1 | hypothetical protein | - |
| MT49_RS10615 | 2261493..2262389 | - | 897 | WP_003410136.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 202 a.a. Molecular weight: 22744.96 Da Isoelectric Point: 7.3073
>T285090 WP_003900449.1 NZ_HG813240:c2259877-2259272 [Mycobacterium tuberculosis 49-02]
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
Download Length: 606 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BV20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7EWC | |
| PDB | 7EWD | |
| PDB | 7EWE | |
| AlphaFold DB | A0A7U4BV30 |