Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
| Location | 2188024..2188892 | Replicon | chromosome |
| Accession | NZ_HG813240 | ||
| Organism | Mycobacterium tuberculosis 49-02 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | P9WJA4 |
| Locus tag | MT49_RS10170 | Protein ID | WP_010886136.1 |
| Coordinates | 2188024..2188401 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | G0TLM0 |
| Locus tag | MT49_RS10175 | Protein ID | WP_003409886.1 |
| Coordinates | 2188443..2188892 (+) | Length | 150 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MT49_RS10120 | 2183813..2184265 | - | 453 | WP_003899095.1 | lipoprotein | - |
| MT49_RS10125 | 2184329..2184730 | + | 402 | WP_003409869.1 | hypothetical protein | - |
| MT49_RS10130 | 2184723..2184905 | - | 183 | WP_003409870.1 | hypothetical protein | - |
| MT49_RS10135 | 2185019..2185369 | - | 351 | WP_003409871.1 | hypothetical protein | - |
| MT49_RS10140 | 2185380..2186282 | - | 903 | WP_003899097.1 | hypothetical protein | - |
| MT49_RS10145 | 2186303..2186494 | - | 192 | WP_003409876.1 | hypothetical protein | - |
| MT49_RS10150 | 2186495..2186791 | - | 297 | WP_003409877.1 | hypothetical protein | - |
| MT49_RS10155 | 2187031..2187246 | + | 216 | WP_003409878.1 | antitoxin | - |
| MT49_RS10160 | 2187243..2187554 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
| MT49_RS22495 | 2187528..2188049 | - | 522 | WP_003904745.1 | hypothetical protein | - |
| MT49_RS10170 | 2188024..2188401 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| MT49_RS10175 | 2188443..2188892 | + | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| MT49_RS10180 | 2188889..2189434 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
| MT49_RS10185 | 2189323..2189937 | - | 615 | WP_003901296.1 | hypothetical protein | - |
| MT49_RS10190 | 2189986..2190282 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| MT49_RS10195 | 2190279..2190530 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| MT49_RS10200 | 2190517..2191011 | + | 495 | WP_003899099.1 | hypothetical protein | - |
| MT49_RS10205 | 2191171..2191578 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
| MT49_RS10210 | 2191582..2191854 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| MT49_RS10215 | 2191887..2193107 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T285084 WP_010886136.1 NZ_HG813240:2188024-2188401 [Mycobacterium tuberculosis 49-02]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16760.16 Da Isoelectric Point: 8.0771
>AT285084 WP_003409886.1 NZ_HG813240:2188443-2188892 [Mycobacterium tuberculosis 49-02]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|