Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4094859..4095511 | Replicon | chromosome |
| Accession | NZ_HG738868 | ||
| Organism | Serratia marcescens SMB2099 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | SMB2099_RS19350 | Protein ID | WP_041036518.1 |
| Coordinates | 4094859..4095203 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A086GAN0 |
| Locus tag | SMB2099_RS19355 | Protein ID | WP_004931828.1 |
| Coordinates | 4095209..4095511 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMB2099_RS19335 | 4091202..4093460 | - | 2259 | WP_079656746.1 | molybdopterin guanine dinucleotide-containing S/N-oxide reductase | - |
| SMB2099_RS19345 | 4093681..4094700 | + | 1020 | WP_033649496.1 | HTH-type transcriptional regulator GalR | - |
| SMB2099_RS19350 | 4094859..4095203 | + | 345 | WP_041036518.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| SMB2099_RS19355 | 4095209..4095511 | + | 303 | WP_004931828.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| SMB2099_RS19360 | 4095539..4096801 | - | 1263 | WP_049232248.1 | diaminopimelate decarboxylase | - |
| SMB2099_RS19365 | 4096935..4097858 | + | 924 | WP_033649494.1 | LysR family transcriptional regulator | - |
| SMB2099_RS19370 | 4097886..4098794 | - | 909 | WP_015378928.1 | LysR family transcriptional regulator | - |
| SMB2099_RS19375 | 4098903..4099787 | + | 885 | WP_041036524.1 | MBL fold metallo-hydrolase | - |
| SMB2099_RS19380 | 4099856..4100503 | + | 648 | WP_033649493.1 | DsbA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13425.48 Da Isoelectric Point: 10.4277
>T285050 WP_041036518.1 NZ_HG738868:4094859-4095203 [Serratia marcescens SMB2099]
MWQVVTVERFDDWFLALNNAQQTSILAAIYKLQTFGPQLTRPHADTLYFSDAVRQLKELRVQHRGRPFRVFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMEFSHYLATRR
MWQVVTVERFDDWFLALNNAQQTSILAAIYKLQTFGPQLTRPHADTLYFSDAVRQLKELRVQHRGRPFRVFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMEFSHYLATRR
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|