Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3343495..3344155 | Replicon | chromosome |
| Accession | NZ_HG738868 | ||
| Organism | Serratia marcescens SMB2099 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2V4GMA7 |
| Locus tag | SMB2099_RS15895 | Protein ID | WP_033647956.1 |
| Coordinates | 3343802..3344155 (-) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A2V4GQ69 |
| Locus tag | SMB2099_RS15890 | Protein ID | WP_033635213.1 |
| Coordinates | 3343495..3343797 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMB2099_RS15870 | 3339114..3340028 | - | 915 | WP_004928592.1 | branched-chain amino acid ABC transporter permease | - |
| SMB2099_RS15875 | 3340154..3341272 | - | 1119 | WP_033647954.1 | branched-chain amino acid ABC transporter substrate-binding protein | - |
| SMB2099_RS15885 | 3341878..3343086 | - | 1209 | WP_041035902.1 | aldose 1-epimerase family protein | - |
| SMB2099_RS15890 | 3343495..3343797 | - | 303 | WP_033635213.1 | XRE family transcriptional regulator | Antitoxin |
| SMB2099_RS15895 | 3343802..3344155 | - | 354 | WP_033647956.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| SMB2099_RS15900 | 3344596..3345891 | + | 1296 | WP_048321788.1 | MFS transporter | - |
| SMB2099_RS15905 | 3345919..3346725 | + | 807 | WP_079656629.1 | substrate-binding domain-containing protein | - |
| SMB2099_RS15910 | 3346700..3347599 | - | 900 | WP_079656630.1 | LysR family transcriptional regulator | - |
| SMB2099_RS15915 | 3347692..3348057 | - | 366 | WP_033635218.1 | diacylglycerol kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13460.30 Da Isoelectric Point: 8.9000
>T285048 WP_033647956.1 NZ_HG738868:c3344155-3343802 [Serratia marcescens SMB2099]
VWEIKTTDAFDNWFSSLHDADRAGVLAALMILREKGPGLPRPYADTVKGSRYSNMKELRIQSRGEPLRAFFAFDPYRIGI
VLCAGNKAGNEKRFYDRMIQAADREFTNWLNTLNEKE
VWEIKTTDAFDNWFSSLHDADRAGVLAALMILREKGPGLPRPYADTVKGSRYSNMKELRIQSRGEPLRAFFAFDPYRIGI
VLCAGNKAGNEKRFYDRMIQAADREFTNWLNTLNEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2V4GMA7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2V4GQ69 |