Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 616664..617317 | Replicon | chromosome |
| Accession | NZ_HG738868 | ||
| Organism | Serratia marcescens SMB2099 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | SMB2099_RS02870 | Protein ID | WP_033645671.1 |
| Coordinates | 616664..617014 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A5C7DBM3 |
| Locus tag | SMB2099_RS02875 | Protein ID | WP_019453270.1 |
| Coordinates | 617018..617317 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMB2099_RS02840 | 612215..612625 | - | 411 | WP_033648574.1 | GNAT family N-acetyltransferase | - |
| SMB2099_RS02845 | 612654..614024 | - | 1371 | WP_039567579.1 | glutamine synthetase family protein | - |
| SMB2099_RS02850 | 614270..614569 | + | 300 | WP_077791580.1 | hypothetical protein | - |
| SMB2099_RS02860 | 614994..615389 | - | 396 | WP_079656958.1 | hypothetical protein | - |
| SMB2099_RS02865 | 615389..616392 | - | 1004 | Protein_538 | hypothetical protein | - |
| SMB2099_RS02870 | 616664..617014 | + | 351 | WP_033645671.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| SMB2099_RS02875 | 617018..617317 | + | 300 | WP_019453270.1 | XRE family transcriptional regulator | Antitoxin |
| SMB2099_RS02880 | 617307..618224 | - | 918 | WP_033648568.1 | LysR family transcriptional regulator | - |
| SMB2099_RS02885 | 618393..619091 | + | 699 | WP_033648567.1 | CoA transferase subunit A | - |
| SMB2099_RS02890 | 619103..619756 | + | 654 | WP_033648566.1 | CoA transferase subunit B | - |
| SMB2099_RS02895 | 619770..620954 | + | 1185 | WP_033648565.1 | acetyl-CoA C-acetyltransferase | - |
| SMB2099_RS02900 | 620973..621896 | + | 924 | WP_033648563.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13546.81 Da Isoelectric Point: 8.2699
>T285041 WP_033645671.1 NZ_HG738868:616664-617014 [Serratia marcescens SMB2099]
MWTVMTTEEFDRWLCEQDESTQEKVLAALVMLERAGPSLRRPFVDVLKGSLHPNMKELRIQHKGRPIRAFFAFDPARQAI
VLCAGDKTGNEKRFYKVMLPIADAQFTQYLMCYFKE
MWTVMTTEEFDRWLCEQDESTQEKVLAALVMLERAGPSLRRPFVDVLKGSLHPNMKELRIQHKGRPIRAFFAFDPARQAI
VLCAGDKTGNEKRFYKVMLPIADAQFTQYLMCYFKE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|