Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3081071..3081293 | Replicon | chromosome |
| Accession | NZ_HG738867 | ||
| Organism | Escherichia coli str. K-12 substr. MC4100 strain K-12 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1E8T8 |
| Locus tag | BN896_RS22490 | Protein ID | WP_000141634.1 |
| Coordinates | 3081186..3081293 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3081071..3081137 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN896_RS15210 (BN896_3231) | 3076512..3077414 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| BN896_RS15215 (BN896_3230) | 3077425..3078408 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| BN896_RS15220 (BN896_3229) | 3078405..3079409 | + | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| BN896_RS15225 (BN896_3228) | 3079439..3080710 | - | 1272 | WP_001295225.1 | transporter | - |
| - | 3081071..3081137 | - | 67 | - | - | Antitoxin |
| BN896_RS22490 (BN896_3227) | 3081186..3081293 | + | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
| BN896_RS15240 (BN896_3226) | 3081380..3083059 | - | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
| BN896_RS15245 (BN896_3225) | 3083056..3083247 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| BN896_RS15250 (BN896_3224) | 3083244..3084815 | - | 1572 | WP_001204931.1 | cellulose biosynthesis protein BcsE | - |
| BN896_RS15255 (BN896_3223) | 3085088..3085276 | + | 189 | WP_001063318.1 | YhjR family protein | - |
| BN896_RS15260 | 3085288..3086040 | + | 753 | Protein_2893 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T285024 WP_000141634.1 NZ_HG738867:3081186-3081293 [Escherichia coli str. K-12 substr. MC4100]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T285024 NZ_HG738867:3081186-3081293 [Escherichia coli str. K-12 substr. MC4100]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT285024 NZ_HG738867:c3081137-3081071 [Escherichia coli str. K-12 substr. MC4100]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|