Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2652119..2652779 | Replicon | chromosome |
| Accession | NZ_HG326223 | ||
| Organism | Serratia marcescens subsp. marcescens Db11 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A656VMD8 |
| Locus tag | SMDB11_RS12350 | Protein ID | WP_025303493.1 |
| Coordinates | 2652426..2652779 (-) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A8G2G5Z5 |
| Locus tag | SMDB11_RS12345 | Protein ID | WP_016927038.1 |
| Coordinates | 2652119..2652421 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMDB11_RS12325 | 2647723..2648637 | - | 915 | WP_004928592.1 | branched-chain amino acid ABC transporter permease | - |
| SMDB11_RS12330 | 2648763..2649881 | - | 1119 | WP_016927040.1 | branched-chain amino acid ABC transporter substrate-binding protein | - |
| SMDB11_RS12340 | 2650487..2651695 | - | 1209 | WP_025303492.1 | aldose 1-epimerase family protein | - |
| SMDB11_RS12345 | 2652119..2652421 | - | 303 | WP_016927038.1 | XRE family transcriptional regulator | Antitoxin |
| SMDB11_RS12350 | 2652426..2652779 | - | 354 | WP_025303493.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| SMDB11_RS12355 | 2653218..2654513 | + | 1296 | WP_025303494.1 | MFS transporter | - |
| SMDB11_RS12360 | 2654540..2655346 | + | 807 | WP_025303495.1 | substrate-binding domain-containing protein | - |
| SMDB11_RS12365 | 2655321..2656220 | - | 900 | WP_025303496.1 | LysR family transcriptional regulator | - |
| SMDB11_RS12370 | 2656324..2656689 | - | 366 | WP_025303497.1 | diacylglycerol kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13548.47 Da Isoelectric Point: 9.0170
>T284995 WP_025303493.1 NZ_HG326223:c2652779-2652426 [Serratia marcescens subsp. marcescens Db11]
VWEIKTTDAFDHWYRSLSDADRAGVLAALMVLREKGPGLPRPYADTVKGSRYSNMKELRIQCRGEPLRAFFAFDPYRIGI
VLCAGNKAGNEKRFYDRMIQVADREFTNWLNTLNEKE
VWEIKTTDAFDHWYRSLSDADRAGVLAALMVLREKGPGLPRPYADTVKGSRYSNMKELRIQCRGEPLRAFFAFDPYRIGI
VLCAGNKAGNEKRFYDRMIQVADREFTNWLNTLNEKE
Download Length: 354 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11093.96 Da Isoelectric Point: 6.4738
>AT284995 WP_016927038.1 NZ_HG326223:c2652421-2652119 [Serratia marcescens subsp. marcescens Db11]
MGRTLEQLIADEKPEVVAKAQALAADIMLNIHLAELREKVQKTQVEMAQALGIRQPTVAVMEKPGRDLKLSSLKRYVEAA
GGKLRLDIELPDGSHYEFVL
MGRTLEQLIADEKPEVVAKAQALAADIMLNIHLAELREKVQKTQVEMAQALGIRQPTVAVMEKPGRDLKLSSLKRYVEAA
GGKLRLDIELPDGSHYEFVL
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|