Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4656258..4656860 | Replicon | chromosome |
Accession | NZ_HF572917 | ||
Organism | Escherichia coli strain HUSEC2011 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | HUS2011_RS24355 | Protein ID | WP_000897305.1 |
Coordinates | 4656258..4656569 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | HUS2011_RS24360 | Protein ID | WP_000356397.1 |
Coordinates | 4656570..4656860 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HUS2011_RS24330 | 4652172..4652771 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
HUS2011_RS24335 | 4652765..4653637 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
HUS2011_RS24340 | 4653634..4654071 | + | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
HUS2011_RS24345 | 4654116..4655057 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
HUS2011_RS24350 | 4655121..4656029 | - | 909 | WP_001387201.1 | alpha/beta hydrolase | - |
HUS2011_RS24355 | 4656258..4656569 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
HUS2011_RS24360 | 4656570..4656860 | + | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
HUS2011_RS24365 | 4657446..4657664 | + | 219 | WP_001315930.1 | ribbon-helix-helix domain-containing protein | - |
HUS2011_RS24370 | 4657884..4658126 | + | 243 | WP_001087409.1 | hypothetical protein | - |
HUS2011_RS24380 | 4658456..4659385 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
HUS2011_RS24385 | 4659382..4660017 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
HUS2011_RS24390 | 4660014..4660916 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T284971 WP_000897305.1 NZ_HF572917:4656258-4656569 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|