Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) DinJ-YafQ (relBE)/YafQ-RelB
Location 2798026..2798571 Replicon chromosome
Accession NZ_HF571988
Organism Yersinia enterocolitica (type O:5) str. YE53/03 isolate host faecal sample

Toxin (Protein)


Gene name yafQ Uniprot ID A0A8B6KSX9
Locus tag YE5303_RS13130 Protein ID WP_005170383.1
Coordinates 2798026..2798304 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID -
Locus tag YE5303_RS13135 Protein ID WP_046051083.1
Coordinates 2798311..2798571 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
YE5303_RS13100 2793395..2794030 + 636 WP_046051077.1 phage baseplate assembly protein V -
YE5303_RS13105 2794027..2794383 + 357 WP_046051078.1 GPW/gp25 family protein -
YE5303_RS13110 2794383..2795291 + 909 WP_046051079.1 baseplate assembly protein -
YE5303_RS13115 2795284..2795832 + 549 WP_046051080.1 phage tail protein I -
YE5303_RS13120 2796076..2797369 + 1294 Protein_2562 phage tail protein -
YE5303_RS13125 2797369..2797983 + 615 WP_046051082.1 tail fiber assembly protein -
YE5303_RS13130 2798026..2798304 - 279 WP_005170383.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
YE5303_RS13135 2798311..2798571 - 261 WP_046051083.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
YE5303_RS13145 2798952..2799158 + 207 WP_046051084.1 host cell division inhibitor Icd-like protein -
YE5303_RS13150 2799148..2799468 + 321 WP_046051085.1 hypothetical protein -
YE5303_RS13155 2799912..2800100 + 189 WP_046051086.1 hypothetical protein -
YE5303_RS13160 2800295..2801191 + 897 WP_072088421.1 Rpn family recombination-promoting nuclease/putative transposase -
YE5303_RS23520 2801402..2801608 + 207 Protein_2570 ash family protein -
YE5303_RS13165 2801760..2801954 + 195 WP_046051088.1 hypothetical protein -
YE5303_RS13170 2802257..2803432 + 1176 WP_046051089.1 phage tail sheath protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - pilW 2770478..2852766 82288


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(4-92)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(4-84)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 11033.77 Da        Isoelectric Point: 9.8470

>T284950 WP_005170383.1 NZ_HF571988:c2798304-2798026 [Yersinia enterocolitica (type O:5) str. YE53/03]
MTKQREIEYSGQFQKDVKKAQKRHKDMNKLKVIMTLLINDKLPLPVVYKDHQLQGNYKGYRDAHIEPDWLIIYKITDDLL
RFERTGSHSDLF

Download         Length: 279 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9293.71 Da        Isoelectric Point: 5.8213

>AT284950 WP_046051083.1 NZ_HF571988:c2798571-2798311 [Yersinia enterocolitica (type O:5) str. YE53/03]
MATNAFVRARIDETLKNEAAAVLAGMGLTVSDLVRITLTKVAREKALPFDLRIPNELTANTIANSEKGVDVHKAKDADDL
FDKLGI

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B6KSX9

Antitoxin

Source ID Structure

References