Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 721085..721860 | Replicon | chromosome |
Accession | NZ_FO834906 | ||
Organism | Klebsiella pneumoniae strain Kp52.145 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | W9B2R2 |
Locus tag | BN49_RS04765 | Protein ID | WP_046042357.1 |
Coordinates | 721375..721860 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | BN49_RS04760 | Protein ID | WP_004150912.1 |
Coordinates | 721085..721378 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN49_RS04740 | 716293..716895 | - | 603 | WP_004174410.1 | short chain dehydrogenase | - |
BN49_RS04745 | 716993..717904 | + | 912 | WP_021314148.1 | LysR family transcriptional regulator | - |
BN49_RS04750 | 717905..719053 | - | 1149 | WP_016531357.1 | PLP-dependent aspartate aminotransferase family protein | - |
BN49_RS04755 | 719064..720440 | - | 1377 | WP_171819465.1 | pyridoxal-phosphate dependent enzyme | - |
BN49_RS04760 | 721085..721378 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
BN49_RS04765 | 721375..721860 | + | 486 | WP_046042357.1 | GNAT family N-acetyltransferase | Toxin |
BN49_RS04770 | 722564..723157 | + | 594 | WP_004188553.1 | hypothetical protein | - |
BN49_RS04775 | 723254..723470 | + | 217 | Protein_703 | transposase | - |
BN49_RS04785 | 723985..724698 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 723254..723406 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17611.64 Da Isoelectric Point: 8.5144
>T284928 WP_046042357.1 NZ_FO834906:721375-721860 [Klebsiella pneumoniae]
MILAPESLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MILAPESLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | W9B2R2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |