Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 332343..332929 Replicon chromosome
Accession NZ_FO834906
Organism Klebsiella pneumoniae strain Kp52.145

Toxin (Protein)


Gene name doc Uniprot ID W9BMV7
Locus tag BN49_RS02710 Protein ID WP_004185990.1
Coordinates 332561..332929 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag BN49_RS02705 Protein ID WP_004174006.1
Coordinates 332343..332564 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BN49_RS02685 328500..329426 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
BN49_RS02690 329423..330700 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
BN49_RS02695 330697..331464 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
BN49_RS02700 331466..332179 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
BN49_RS02705 332343..332564 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
BN49_RS02710 332561..332929 + 369 WP_004185990.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
BN49_RS02715 333202..334518 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
BN49_RS02720 334625..335512 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
BN49_RS02725 335509..336354 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
BN49_RS02730 336356..337426 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 329423..338163 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13469.85 Da        Isoelectric Point: 8.0667

>T284926 WP_004185990.1 NZ_FO834906:332561-332929 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVCRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT284926 WP_004174006.1 NZ_FO834906:332343-332564 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W9BMV7

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References