Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) tisB-istR/TisB(toxin)
Location 32841..33216 Replicon chromosome
Accession NZ_FO834906
Organism Klebsiella pneumoniae strain Kp52.145

Toxin (Protein)


Gene name tisB Uniprot ID A0A0H3GV52
Locus tag BN49_RS01295 Protein ID WP_004145059.1
Coordinates 32841..32960 (-) Length 40 a.a.

Antitoxin (RNA)


Gene name istR
Locus tag -
Coordinates 33137..33216 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BN49_RS30805 28855..28959 + 105 WP_040146642.1 hypothetical protein -
BN49_RS01275 28959..29882 + 924 WP_004150274.1 DNA-binding transcriptional regulator DsdC -
BN49_RS01280 30042..31226 - 1185 WP_004181587.1 multidrug efflux MFS transporter EmrD -
BN49_RS01285 31402..32235 - 834 WP_002923296.1 DMT family transporter -
BN49_RS01290 32304..32750 - 447 WP_002923294.1 GNAT family N-acetyltransferase -
BN49_RS01295 32841..32960 - 120 WP_004145059.1 type I toxin-antitoxin system toxin TisB Toxin
- 33137..33216 + 80 - - Antitoxin
BN49_RS30810 33164..33331 - 168 WP_014343455.1 hypothetical protein -
BN49_RS28505 33344..33439 + 96 WP_002923286.1 ilvB operon leader peptide IvbL -
BN49_RS01300 33544..35232 + 1689 WP_004173858.1 acetolactate synthase large subunit -
BN49_RS01305 35236..35523 + 288 WP_002923283.1 acetolactate synthase small subunit -
BN49_RS01310 35674..36267 + 594 WP_002923282.1 transcriptional regulator UhpA -
BN49_RS01315 36285..37766 + 1482 WP_004151519.1 signal transduction histidine-protein kinase/phosphatase UhpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin TisB, type I toxin-antitoxin system

(11-38)


Sequences

Toxin        


Download         Length: 40 a.a.        Molecular weight: 4292.34 Da        Isoelectric Point: 7.9965

>T284924 WP_004145059.1 NZ_FO834906:c32960-32841 [Klebsiella pneumoniae]
MCSLTTGDARMGGMDIIILILKLMVAVLQLLDAVLKQFR

Download         Length: 120 bp

Antitoxin


Download         Length: 80 bp

>AT284924 NZ_FO834906:33137-33216 [Klebsiella pneumoniae]
TGTTGACGTAACACAGTGTGCTTGCGGCTACCACCTGTAACCATGCTGATAAAAACCTCGCTCCGGCGGGGTTTTTTGTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GV52

Antitoxin

Download structure file

References