Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 114378..115052 | Replicon | plasmid megaplasmid |
Accession | NZ_FO818638 | ||
Organism | Xenorhabdus bovienii strain CS03 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0B6XEM2 |
Locus tag | XBW1_RS21965 | Protein ID | WP_046338236.1 |
Coordinates | 114378..114701 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | XBW1_RS21970 | Protein ID | WP_046338237.1 |
Coordinates | 114756..115052 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XBW1_RS21945 | 109617..111197 | - | 1581 | WP_046338233.1 | hypothetical protein | - |
XBW1_RS21950 | 111243..113033 | - | 1791 | WP_065814070.1 | capsid protein | - |
XBW1_RS21955 | 113213..113629 | + | 417 | WP_046338234.1 | hypothetical protein | - |
XBW1_RS21960 | 113670..114047 | + | 378 | WP_046338235.1 | DUF2591 family protein | - |
XBW1_RS21965 | 114378..114701 | + | 324 | WP_046338236.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
XBW1_RS21970 | 114756..115052 | + | 297 | WP_046338237.1 | helix-turn-helix domain-containing protein | Antitoxin |
XBW1_RS23675 | 115054..115170 | + | 117 | WP_155399224.1 | toxin-antitoxin system HicB family antitoxin | - |
XBW1_RS22675 | 115461..115913 | - | 453 | WP_052726145.1 | hypothetical protein | - |
XBW1_RS21980 | 115922..116662 | - | 741 | WP_046338239.1 | hypothetical protein | - |
XBW1_RS21985 | 116959..117795 | - | 837 | WP_046338240.1 | Dam family site-specific DNA-(adenine-N6)-methyltransferase | - |
XBW1_RS21990 | 117788..118720 | - | 933 | WP_052726146.1 | recombination-associated protein RdgC | - |
XBW1_RS22815 | 118935..119180 | + | 246 | WP_046338241.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
XBW1_RS22000 | 119180..119530 | + | 351 | WP_046338292.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..177250 | 177250 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12582.48 Da Isoelectric Point: 9.6096
>T284919 WP_046338236.1 NZ_FO818638:114378-114701 [Xenorhabdus bovienii]
MDYLEFIETTTFSRVRTELMEDDELQELQDHLLKHHEKGDTISQTGGCKKIRWSRKGMGKRGGIRVIYYVRTLSGRLYLL
LVYPKNAQADLTQDQKTQLKNAIQYMK
MDYLEFIETTTFSRVRTELMEDDELQELQDHLLKHHEKGDTISQTGGCKKIRWSRKGMGKRGGIRVIYYVRTLSGRLYLL
LVYPKNAQADLTQDQKTQLKNAIQYMK
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|