Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4328..4974 | Replicon | plasmid megaplasmid |
Accession | NZ_FO818638 | ||
Organism | Xenorhabdus bovienii strain CS03 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A077NLI8 |
Locus tag | XBW1_RS21405 | Protein ID | WP_038197339.1 |
Coordinates | 4624..4974 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A077NWX3 |
Locus tag | XBW1_RS21400 | Protein ID | WP_038197338.1 |
Coordinates | 4328..4627 (-) | Length | 100 a.a. |
Genomic Context
Location: 154..1161 (1008 bp)
Type: Others
Protein ID: WP_046338156.1
Type: Others
Protein ID: WP_046338156.1
Location: 1574..1743 (170 bp)
Type: Others
Protein ID: Protein_1
Type: Others
Protein ID: Protein_1
Location: 1808..2498 (691 bp)
Type: Others
Protein ID: Protein_2
Type: Others
Protein ID: Protein_2
Location: 2538..2681 (144 bp)
Type: Others
Protein ID: WP_082243393.1
Type: Others
Protein ID: WP_082243393.1
Location: 2906..3247 (342 bp)
Type: Others
Protein ID: WP_038195432.1
Type: Others
Protein ID: WP_038195432.1
Location: 3487..4180 (694 bp)
Type: Others
Protein ID: WP_155399208.1
Type: Others
Protein ID: WP_155399208.1
Location: 6003..6335 (333 bp)
Type: Others
Protein ID: WP_038196315.1
Type: Others
Protein ID: WP_038196315.1
Location: 6325..6660 (336 bp)
Type: Others
Protein ID: WP_046338158.1
Type: Others
Protein ID: WP_046338158.1
Location: 6986..7660 (675 bp)
Type: Others
Protein ID: WP_172664735.1
Type: Others
Protein ID: WP_172664735.1
Location: 4328..4627 (300 bp)
Type: Antitoxin
Protein ID: WP_038197338.1
Type: Antitoxin
Protein ID: WP_038197338.1
Location: 4624..4974 (351 bp)
Type: Toxin
Protein ID: WP_038197339.1
Type: Toxin
Protein ID: WP_038197339.1
Location: 5144..5834 (691 bp)
Type: Others
Protein ID: Protein_8
Type: Others
Protein ID: Protein_8
Location: 6758..6889 (132 bp)
Type: Others
Protein ID: Protein_11
Type: Others
Protein ID: Protein_11
Location: 7668..7739 (72 bp)
Type: Others
Protein ID: WP_071839248.1
Type: Others
Protein ID: WP_071839248.1
Location: 7963..8181 (219 bp)
Type: Others
Protein ID: WP_046338161.1
Type: Others
Protein ID: WP_046338161.1
Location: 8493..9452 (960 bp)
Type: Others
Protein ID: WP_046338162.1
Type: Others
Protein ID: WP_046338162.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XBW1_RS21375 | 154..1161 | + | 1008 | WP_046338156.1 | RepB family plasmid replication initiator protein | - |
XBW1_RS24965 | 1574..1743 | + | 170 | Protein_1 | IS6 family transposase | - |
XBW1_RS21385 | 1808..2498 | + | 691 | Protein_2 | IS6 family transposase | - |
XBW1_RS23640 | 2538..2681 | + | 144 | WP_082243393.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
XBW1_RS21390 | 2906..3247 | + | 342 | WP_038195432.1 | VOC family protein | - |
XBW1_RS21395 | 3487..4180 | + | 694 | WP_155399208.1 | IS6 family transposase | - |
XBW1_RS21400 | 4328..4627 | - | 300 | WP_038197338.1 | XRE family transcriptional regulator | Antitoxin |
XBW1_RS21405 | 4624..4974 | - | 351 | WP_038197339.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
XBW1_RS21410 | 5144..5834 | - | 691 | Protein_8 | IS6 family transposase | - |
XBW1_RS21415 | 6003..6335 | + | 333 | WP_038196315.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
XBW1_RS21420 | 6325..6660 | + | 336 | WP_046338158.1 | hypothetical protein | - |
XBW1_RS25235 | 6758..6889 | - | 132 | Protein_11 | IS6 family transposase | - |
XBW1_RS21425 | 6986..7660 | + | 675 | WP_172664735.1 | transposase | - |
XBW1_RS23645 | 7668..7739 | - | 72 | WP_071839248.1 | transposase | - |
XBW1_RS21430 | 7963..8181 | - | 219 | WP_046338161.1 | hypothetical protein | - |
XBW1_RS21435 | 8493..9452 | - | 960 | WP_046338162.1 | SDR family NAD(P)-dependent oxidoreductase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..177250 | 177250 | |
- | inside | IScluster/Tn | - | - | 1574..5834 | 4260 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13570.46 Da Isoelectric Point: 7.2767
>T284917 WP_038197339.1 NZ_FO818638:c4974-4624 [Xenorhabdus bovienii]
MWTVIFTPRFDAWLQEQEEGMQEKVLADLTNLETYGPKLSRPYADTVKGSRHKNMKELRVQYSGHPVRAFFAFDPKRQAI
VLCAGDKSNNKRFYDTMIRIADEEFTAHLTVIEEQK
MWTVIFTPRFDAWLQEQEEGMQEKVLADLTNLETYGPKLSRPYADTVKGSRHKNMKELRVQYSGHPVRAFFAFDPKRQAI
VLCAGDKSNNKRFYDTMIRIADEEFTAHLTVIEEQK
Download Length: 351 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A077NLI8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A077NWX3 |