Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 4328..4974 Replicon plasmid megaplasmid
Accession NZ_FO818638
Organism Xenorhabdus bovienii strain CS03

Toxin (Protein)


Gene name higB Uniprot ID A0A077NLI8
Locus tag XBW1_RS21405 Protein ID WP_038197339.1
Coordinates 4624..4974 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A077NWX3
Locus tag XBW1_RS21400 Protein ID WP_038197338.1
Coordinates 4328..4627 (-) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
XBW1_RS21375 154..1161 + 1008 WP_046338156.1 RepB family plasmid replication initiator protein -
XBW1_RS24965 1574..1743 + 170 Protein_1 IS6 family transposase -
XBW1_RS21385 1808..2498 + 691 Protein_2 IS6 family transposase -
XBW1_RS23640 2538..2681 + 144 WP_082243393.1 type II toxin-antitoxin system RelE/ParE family toxin -
XBW1_RS21390 2906..3247 + 342 WP_038195432.1 VOC family protein -
XBW1_RS21395 3487..4180 + 694 WP_155399208.1 IS6 family transposase -
XBW1_RS21400 4328..4627 - 300 WP_038197338.1 XRE family transcriptional regulator Antitoxin
XBW1_RS21405 4624..4974 - 351 WP_038197339.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
XBW1_RS21410 5144..5834 - 691 Protein_8 IS6 family transposase -
XBW1_RS21415 6003..6335 + 333 WP_038196315.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
XBW1_RS21420 6325..6660 + 336 WP_046338158.1 hypothetical protein -
XBW1_RS25235 6758..6889 - 132 Protein_11 IS6 family transposase -
XBW1_RS21425 6986..7660 + 675 WP_172664735.1 transposase -
XBW1_RS23645 7668..7739 - 72 WP_071839248.1 transposase -
XBW1_RS21430 7963..8181 - 219 WP_046338161.1 hypothetical protein -
XBW1_RS21435 8493..9452 - 960 WP_046338162.1 SDR family NAD(P)-dependent oxidoreductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..177250 177250
- inside IScluster/Tn - - 1574..5834 4260


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-105)

Antitoxin

Cro/C1-type helix-turn-helix domain

(32-80)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13570.46 Da        Isoelectric Point: 7.2767

>T284917 WP_038197339.1 NZ_FO818638:c4974-4624 [Xenorhabdus bovienii]
MWTVIFTPRFDAWLQEQEEGMQEKVLADLTNLETYGPKLSRPYADTVKGSRHKNMKELRVQYSGHPVRAFFAFDPKRQAI
VLCAGDKSNNKRFYDTMIRIADEEFTAHLTVIEEQK

Download         Length: 351 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 10974.70 Da        Isoelectric Point: 5.8787

>AT284917 WP_038197338.1 NZ_FO818638:c4627-4328 [Xenorhabdus bovienii]
MKTLRDAVAARSPESQARIKEMADEMILETGLQLMREELQFSQKSLAESMGVSQPAITQIEQRGNDVKLATLKRYIEAMG
GKLSLTVELPEGGGRIFHI

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A077NLI8

Antitoxin

Source ID Structure
AlphaFold DB A0A077NWX3

References