Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-HTH
Location 1751830..1752434 Replicon chromosome
Accession NZ_FO818637
Organism Xenorhabdus bovienii strain CS03

Toxin (Protein)


Gene name higB Uniprot ID A0A077NT86
Locus tag XBW1_RS08290 Protein ID WP_038223617.1
Coordinates 1751830..1752141 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag XBW1_RS08295 Protein ID WP_038182073.1
Coordinates 1752144..1752434 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
XBW1_RS08260 1747771..1748949 - 1179 WP_046336590.1 tyrosine-type recombinase/integrase -
XBW1_RS08270 1749381..1750022 + 642 WP_082243316.1 Arm DNA-binding domain-containing protein -
XBW1_RS23130 1749968..1750183 - 216 WP_071839192.1 hypothetical protein -
XBW1_RS08275 1750193..1750486 - 294 WP_046336591.1 hypothetical protein -
XBW1_RS08280 1750471..1750677 - 207 WP_046336592.1 hypothetical protein -
XBW1_RS08285 1750832..1751278 + 447 Protein_1653 winged helix-turn-helix domain-containing protein -
XBW1_RS08290 1751830..1752141 + 312 WP_038223617.1 toxin HigB-2 Toxin
XBW1_RS08295 1752144..1752434 + 291 WP_038182073.1 helix-turn-helix domain-containing protein Antitoxin
XBW1_RS08300 1752619..1752924 + 306 WP_155271852.1 hypothetical protein -
XBW1_RS23925 1752966..1753241 - 276 WP_046336593.1 DUF4236 domain-containing protein -
XBW1_RS22735 1753384..1753689 - 306 WP_038223619.1 Arc family DNA-binding protein -
XBW1_RS24545 1753761..1753940 + 180 WP_155271853.1 hypothetical protein -
XBW1_RS24550 1754040..1754381 + 342 Protein_1660 KilA-N domain-containing protein -
XBW1_RS24555 1754484..1754798 + 315 WP_155399196.1 phage antirepressor KilAC domain-containing protein -
XBW1_RS08320 1755047..1755760 + 714 WP_082243317.1 phage antirepressor N-terminal domain-containing protein -
XBW1_RS24560 1755959..1756132 + 174 WP_155270976.1 hypothetical protein -
XBW1_RS08325 1756129..1756542 + 414 WP_052726022.1 type II toxin-antitoxin system death-on-curing family toxin -
XBW1_RS08335 1756988..1757194 + 207 WP_038223228.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1743472..1785601 42129


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(42-100)

Antitoxin

Cro/C1-type helix-turn-helix domain

(37-74)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 11993.73 Da        Isoelectric Point: 8.8435

>T284912 WP_038223617.1 NZ_FO818637:1751830-1752141 [Xenorhabdus bovienii]
MIFIETHIFTEDCKELLSDDEYREFQQYLADNPATGDVIQHTGGLRKVRWASRGKGKRGGVRVIYYHKVDVSHIRLLLIY
KKGIKDDLSESEKKVLRALNEGW

Download         Length: 312 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10627.32 Da        Isoelectric Point: 10.7721

>AT284912 WP_038182073.1 NZ_FO818637:1752144-1752434 [Xenorhabdus bovienii]
MDSKLFSRLTESMTQMNEIMNGERAASRETTIEAVKVKNIRQATGLSQTGFAKLISVNVGTLRNWEQGRREPTGPAKALL
KAIEKDPVHVLKALSM

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A077NT86

Antitoxin

Source ID Structure

References