Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 578713..579315 | Replicon | chromosome |
Accession | NZ_FO704550 | ||
Organism | Xenorhabdus doucetiae strain FRM16 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A068QN01 |
Locus tag | XDD1_RS02840 | Protein ID | WP_045968495.1 |
Coordinates | 578713..579024 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | XDD1_RS02845 | Protein ID | WP_045968497.1 |
Coordinates | 579025..579315 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XDD1_RS02825 | 575384..576379 | + | 996 | WP_045973307.1 | gluconate operon transcriptional repressor GntR | - |
XDD1_RS02830 | 576636..577193 | + | 558 | WP_045968491.1 | gluconokinase | - |
XDD1_RS02835 | 577190..578527 | + | 1338 | WP_045968493.1 | gluconate transporter | - |
XDD1_RS02840 | 578713..579024 | + | 312 | WP_045968495.1 | toxin HigB-2 | Toxin |
XDD1_RS02845 | 579025..579315 | + | 291 | WP_045968497.1 | helix-turn-helix domain-containing protein | Antitoxin |
XDD1_RS02850 | 579537..580751 | - | 1215 | WP_045968499.1 | SGNH/GDSL hydrolase family protein | - |
XDD1_RS02855 | 580738..581874 | - | 1137 | WP_045968502.1 | DUF459 domain-containing protein | - |
XDD1_RS02860 | 581861..582550 | - | 690 | Protein_539 | MBOAT family protein | - |
XDD1_RS02865 | 582558..583595 | - | 1038 | WP_045968390.1 | IS630 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12349.36 Da Isoelectric Point: 9.9915
>T284893 WP_045968495.1 NZ_FO704550:578713-579024 [Xenorhabdus doucetiae]
MLFIETKLFTDDVVQLLTDDEYREFQEFLAIRPEFGQVIPDTGGLRKIRWASYRTGKRGGVRIIYYYKLSDSQIRLLLIY
KKGIKDNLTEKEKKILRSLNERW
MLFIETKLFTDDVVQLLTDDEYREFQEFLAIRPEFGQVIPDTGGLRKIRWASYRTGKRGGVRIIYYYKLSDSQIRLLLIY
KKGIKDNLTEKEKKILRSLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|