Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 5399282..5400072 | Replicon | chromosome |
| Accession | NZ_CP128550 | ||
| Organism | Pseudomonas alloputida strain NMI5594_09 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | Q88NE5 |
| Locus tag | LU693_RS25080 | Protein ID | WP_010952397.1 |
| Coordinates | 5399605..5400072 (+) | Length | 156 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | I7C311 |
| Locus tag | LU693_RS25075 | Protein ID | WP_014859917.1 |
| Coordinates | 5399282..5399608 (+) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU693_RS25055 (LU693_025055) | 5394816..5395877 | - | 1062 | WP_049587435.1 | HlyD family secretion protein | - |
| LU693_RS25060 (LU693_025060) | 5395906..5397447 | - | 1542 | WP_010952401.1 | MFS transporter | - |
| LU693_RS25065 (LU693_025065) | 5397564..5398469 | - | 906 | WP_010952400.1 | LysR family transcriptional regulator | - |
| LU693_RS25070 (LU693_025070) | 5398743..5399189 | + | 447 | WP_010952399.1 | universal stress protein | - |
| LU693_RS25075 (LU693_025075) | 5399282..5399608 | + | 327 | WP_014859917.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| LU693_RS25080 (LU693_025080) | 5399605..5400072 | + | 468 | WP_010952397.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| LU693_RS25085 (LU693_025085) | 5400145..5401005 | - | 861 | WP_010952396.1 | HlyD family secretion protein | - |
| LU693_RS25090 (LU693_025090) | 5401016..5401216 | - | 201 | WP_003251718.1 | DUF1656 domain-containing protein | - |
| LU693_RS25095 (LU693_025095) | 5401206..5403383 | - | 2178 | WP_003251716.1 | FUSC family protein | - |
| LU693_RS25100 (LU693_025100) | 5403380..5404909 | - | 1530 | WP_010952395.1 | efflux transporter outer membrane subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 17962.34 Da Isoelectric Point: 9.7963
>T284876 WP_010952397.1 NZ_CP128550:5399605-5400072 [Pseudomonas alloputida]
MSDASRKPLVIHGWTVIAHPLFLAKLDALSAQVEAQRDKDPTGYTKRNTFKRLAAIRRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWINDESSKRAYESSDDAYKVFQKMLHSGNPPDDWDQLLQEAAAD
MSDASRKPLVIHGWTVIAHPLFLAKLDALSAQVEAQRDKDPTGYTKRNTFKRLAAIRRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWINDESSKRAYESSDDAYKVFQKMLHSGNPPDDWDQLLQEAAAD
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|