Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 1972848..1973548 | Replicon | chromosome |
Accession | NZ_CP128550 | ||
Organism | Pseudomonas alloputida strain NMI5594_09 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | Q88F93 |
Locus tag | LU693_RS09010 | Protein ID | WP_010954960.1 |
Coordinates | 1972848..1973144 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | I7AUJ7 |
Locus tag | LU693_RS09015 | Protein ID | WP_003254235.1 |
Coordinates | 1973147..1973548 (+) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LU693_RS08990 (LU693_008990) | 1968840..1970018 | - | 1179 | WP_010954964.1 | efflux RND transporter periplasmic adaptor subunit | - |
LU693_RS08995 (LU693_008995) | 1970231..1970707 | + | 477 | WP_010954963.1 | sigma-70 family RNA polymerase sigma factor | - |
LU693_RS09000 (LU693_009000) | 1970876..1971355 | + | 480 | WP_010954962.1 | hypothetical protein | - |
LU693_RS09005 (LU693_009005) | 1971428..1972753 | + | 1326 | WP_010954961.1 | MFS transporter | - |
LU693_RS09010 (LU693_009010) | 1972848..1973144 | + | 297 | WP_010954960.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
LU693_RS09015 (LU693_009015) | 1973147..1973548 | + | 402 | WP_003254235.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
LU693_RS09020 (LU693_009020) | 1973620..1975302 | - | 1683 | WP_010954959.1 | electron transfer flavoprotein-ubiquinone oxidoreductase | - |
LU693_RS09025 (LU693_009025) | 1975838..1976587 | + | 750 | WP_003254232.1 | electron transfer flavoprotein subunit beta/FixA family protein | - |
LU693_RS09030 (LU693_009030) | 1976588..1977517 | + | 930 | WP_010954958.1 | FAD-binding protein | - |
LU693_RS09035 (LU693_009035) | 1977593..1978414 | + | 822 | WP_010954957.1 | transporter substrate-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11133.22 Da Isoelectric Point: 10.2271
>T284872 WP_010954960.1 NZ_CP128550:1972848-1973144 [Pseudomonas alloputida]
MEKRMPHCPLERVKALAAARRIRPTGAALKGAKALGMDFPGMLEVITSLKRTDFYKSMTSHIDHRVWQDVYRPLTAIGYV
YLKLSVVDDVLIVSFKEL
MEKRMPHCPLERVKALAAARRIRPTGAALKGAKALGMDFPGMLEVITSLKRTDFYKSMTSHIDHRVWQDVYRPLTAIGYV
YLKLSVVDDVLIVSFKEL
Download Length: 297 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14684.76 Da Isoelectric Point: 4.9531
>AT284872 WP_003254235.1 NZ_CP128550:1973147-1973548 [Pseudomonas alloputida]
MRCPICGGSELAPDIQGMPYSYKGEMTVIPEVSGDYCSACGECVLSHDEAMRVSHLMTAFERQVNANVVDPSFIASIRRK
FDLDQREAGEIFGGGVNAFSRYENGKTTPPVALVKLLKLLDRHPELFEEVRTA
MRCPICGGSELAPDIQGMPYSYKGEMTVIPEVSGDYCSACGECVLSHDEAMRVSHLMTAFERQVNANVVDPSFIASIRRK
FDLDQREAGEIFGGGVNAFSRYENGKTTPPVALVKLLKLLDRHPELFEEVRTA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|