Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 1449666..1450267 | Replicon | chromosome |
Accession | NZ_CP128550 | ||
Organism | Pseudomonas alloputida strain NMI5594_09 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A2L1IAQ2 |
Locus tag | LU693_RS06610 | Protein ID | WP_049587984.1 |
Coordinates | 1449953..1450267 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A2L1IAR7 |
Locus tag | LU693_RS06605 | Protein ID | WP_049587986.1 |
Coordinates | 1449666..1449953 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LU693_RS06585 (LU693_006585) | 1444698..1445543 | + | 846 | WP_003254799.1 | DUF6502 family protein | - |
LU693_RS06590 (LU693_006590) | 1445540..1447258 | + | 1719 | WP_010952348.1 | DUF5666 domain-containing protein | - |
LU693_RS06595 (LU693_006595) | 1447313..1448062 | + | 750 | WP_049587988.1 | hypothetical protein | - |
LU693_RS06600 (LU693_006600) | 1448134..1449465 | - | 1332 | WP_004576169.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
LU693_RS06605 (LU693_006605) | 1449666..1449953 | - | 288 | WP_049587986.1 | helix-turn-helix domain-containing protein | Antitoxin |
LU693_RS06610 (LU693_006610) | 1449953..1450267 | - | 315 | WP_049587984.1 | hypothetical protein | Toxin |
LU693_RS06615 (LU693_006615) | 1450716..1452626 | + | 1911 | WP_010952353.1 | potassium transporter Kup | - |
LU693_RS06620 (LU693_006620) | 1452675..1453967 | - | 1293 | WP_010952354.1 | AcvB/VirJ family lysyl-phosphatidylglycerol hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11784.61 Da Isoelectric Point: 9.9097
>T284871 WP_049587984.1 NZ_CP128550:c1450267-1449953 [Pseudomonas alloputida]
MIFIETPVFTSDLKEHLDDEEYRALQAYLAEHPEAGSLLEETGGLRKIRWAAKGKGKSGGVRVIYYHVTAAHQIRMILIY
RKGIVDTLTSSQKAQLRALNKGWK
MIFIETPVFTSDLKEHLDDEEYRALQAYLAEHPEAGSLLEETGGLRKIRWAAKGKGKSGGVRVIYYHVTAAHQIRMILIY
RKGIVDTLTSSQKAQLRALNKGWK
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2L1IAQ2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2L1IAR7 |