Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 5157919..5158709 | Replicon | chromosome |
| Accession | NZ_CP128546 | ||
| Organism | Pseudomonas monteilii strain NMI8712_11 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A3G2HLC0 |
| Locus tag | LU654_RS24165 | Protein ID | WP_016713503.1 |
| Coordinates | 5158242..5158709 (+) | Length | 156 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A0P7D0H8 |
| Locus tag | LU654_RS24160 | Protein ID | WP_016713504.1 |
| Coordinates | 5157919..5158245 (+) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU654_RS24140 (LU654_024140) | 5153455..5154516 | - | 1062 | WP_016713508.1 | HlyD family secretion protein | - |
| LU654_RS24145 (LU654_024145) | 5154545..5156086 | - | 1542 | WP_016713507.1 | MFS transporter | - |
| LU654_RS24150 (LU654_024150) | 5156203..5157108 | - | 906 | WP_016713506.1 | LysR family transcriptional regulator | - |
| LU654_RS24155 (LU654_024155) | 5157379..5157825 | + | 447 | WP_016713505.1 | universal stress protein | - |
| LU654_RS24160 (LU654_024160) | 5157919..5158245 | + | 327 | WP_016713504.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| LU654_RS24165 (LU654_024165) | 5158242..5158709 | + | 468 | WP_016713503.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| LU654_RS24170 (LU654_024170) | 5158755..5159615 | - | 861 | WP_121757793.1 | HlyD family secretion protein | - |
| LU654_RS24175 (LU654_024175) | 5159626..5159826 | - | 201 | WP_009685040.1 | DUF1656 domain-containing protein | - |
| LU654_RS24180 (LU654_024180) | 5159816..5161993 | - | 2178 | WP_016713501.1 | FUSC family protein | - |
| LU654_RS24185 (LU654_024185) | 5161990..5163519 | - | 1530 | WP_016713500.1 | efflux transporter outer membrane subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 18037.56 Da Isoelectric Point: 10.0504
>T284858 WP_016713503.1 NZ_CP128546:5158242-5158709 [Pseudomonas monteilii]
MSDASRKPLVIHGWTVIAHPLFLAKLEALSAQVQAQMHKDPTGYTRRNAYKRLAAIKRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWVNDESSKRAYESSDDAYKVFQKMLHTGHPPDDWEQLLREAAAE
MSDASRKPLVIHGWTVIAHPLFLAKLEALSAQVQAQMHKDPTGYTRRNAYKRLAAIKRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWVNDESSKRAYESSDDAYKVFQKMLHTGHPPDDWEQLLREAAAE
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3G2HLC0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P7D0H8 |