Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 5192979..5193769 | Replicon | chromosome |
| Accession | NZ_CP128545 | ||
| Organism | Pseudomonas monteilii strain NMI6266_12 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A3G2HLC0 |
| Locus tag | LU662_RS24740 | Protein ID | WP_016713503.1 |
| Coordinates | 5193302..5193769 (+) | Length | 156 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A0P7D0H8 |
| Locus tag | LU662_RS24735 | Protein ID | WP_016713504.1 |
| Coordinates | 5192979..5193305 (+) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU662_RS24715 (LU662_024715) | 5188515..5189576 | - | 1062 | WP_016713508.1 | HlyD family secretion protein | - |
| LU662_RS24720 (LU662_024720) | 5189605..5191146 | - | 1542 | WP_016713507.1 | MFS transporter | - |
| LU662_RS24725 (LU662_024725) | 5191263..5192168 | - | 906 | WP_016713506.1 | LysR family transcriptional regulator | - |
| LU662_RS24730 (LU662_024730) | 5192439..5192885 | + | 447 | WP_016713505.1 | universal stress protein | - |
| LU662_RS24735 (LU662_024735) | 5192979..5193305 | + | 327 | WP_016713504.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| LU662_RS24740 (LU662_024740) | 5193302..5193769 | + | 468 | WP_016713503.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| LU662_RS24745 (LU662_024745) | 5193815..5194675 | - | 861 | WP_121757793.1 | HlyD family secretion protein | - |
| LU662_RS24750 (LU662_024750) | 5194686..5194886 | - | 201 | WP_009685040.1 | DUF1656 domain-containing protein | - |
| LU662_RS24755 (LU662_024755) | 5194876..5197053 | - | 2178 | WP_016713501.1 | FUSC family protein | - |
| LU662_RS24760 (LU662_024760) | 5197050..5198579 | - | 1530 | WP_016713500.1 | efflux transporter outer membrane subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 18037.56 Da Isoelectric Point: 10.0504
>T284856 WP_016713503.1 NZ_CP128545:5193302-5193769 [Pseudomonas monteilii]
MSDASRKPLVIHGWTVIAHPLFLAKLEALSAQVQAQMHKDPTGYTRRNAYKRLAAIKRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWVNDESSKRAYESSDDAYKVFQKMLHTGHPPDDWEQLLREAAAE
MSDASRKPLVIHGWTVIAHPLFLAKLEALSAQVQAQMHKDPTGYTRRNAYKRLAAIKRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWVNDESSKRAYESSDDAYKVFQKMLHTGHPPDDWEQLLREAAAE
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3G2HLC0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P7D0H8 |