Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 5256209..5256999 | Replicon | chromosome |
Accession | NZ_CP128541 | ||
Organism | Pseudomonas monteilii strain NMI135_16 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A3G2HLC0 |
Locus tag | LU690_RS24820 | Protein ID | WP_016713503.1 |
Coordinates | 5256532..5256999 (+) | Length | 156 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | A0A0P7D0H8 |
Locus tag | LU690_RS24815 | Protein ID | WP_016713504.1 |
Coordinates | 5256209..5256535 (+) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LU690_RS24795 (LU690_24795) | 5251745..5252806 | - | 1062 | WP_016713508.1 | HlyD family secretion protein | - |
LU690_RS24800 (LU690_24800) | 5252835..5254376 | - | 1542 | WP_016713507.1 | MFS transporter | - |
LU690_RS24805 (LU690_24805) | 5254493..5255398 | - | 906 | WP_016713506.1 | LysR family transcriptional regulator | - |
LU690_RS24810 (LU690_24810) | 5255669..5256115 | + | 447 | WP_016713505.1 | universal stress protein | - |
LU690_RS24815 (LU690_24815) | 5256209..5256535 | + | 327 | WP_016713504.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
LU690_RS24820 (LU690_24820) | 5256532..5256999 | + | 468 | WP_016713503.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
LU690_RS24825 (LU690_24825) | 5257045..5257905 | - | 861 | WP_121757793.1 | HlyD family secretion protein | - |
LU690_RS24830 (LU690_24830) | 5257916..5258116 | - | 201 | WP_009685040.1 | DUF1656 domain-containing protein | - |
LU690_RS24835 (LU690_24835) | 5258106..5260283 | - | 2178 | WP_016713501.1 | FUSC family protein | - |
LU690_RS24840 (LU690_24840) | 5260280..5261809 | - | 1530 | WP_016713500.1 | efflux transporter outer membrane subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 18037.56 Da Isoelectric Point: 10.0504
>T284841 WP_016713503.1 NZ_CP128541:5256532-5256999 [Pseudomonas monteilii]
MSDASRKPLVIHGWTVIAHPLFLAKLEALSAQVQAQMHKDPTGYTRRNAYKRLAAIKRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWVNDESSKRAYESSDDAYKVFQKMLHTGHPPDDWEQLLREAAAE
MSDASRKPLVIHGWTVIAHPLFLAKLEALSAQVQAQMHKDPTGYTRRNAYKRLAAIKRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWVNDESSKRAYESSDDAYKVFQKMLHTGHPPDDWEQLLREAAAE
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G2HLC0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P7D0H8 |