Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 5391317..5392107 | Replicon | chromosome |
| Accession | NZ_CP128540 | ||
| Organism | Pseudomonas alloputida strain NMI24_14 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | Q88NE5 |
| Locus tag | LU682_RS25050 | Protein ID | WP_010952397.1 |
| Coordinates | 5391640..5392107 (+) | Length | 156 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | I7C311 |
| Locus tag | LU682_RS25045 | Protein ID | WP_014859917.1 |
| Coordinates | 5391317..5391643 (+) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU682_RS25025 (LU682_025025) | 5386851..5387912 | - | 1062 | WP_049587435.1 | HlyD family secretion protein | - |
| LU682_RS25030 (LU682_025030) | 5387941..5389482 | - | 1542 | WP_010952401.1 | MFS transporter | - |
| LU682_RS25035 (LU682_025035) | 5389599..5390504 | - | 906 | WP_010952400.1 | LysR family transcriptional regulator | - |
| LU682_RS25040 (LU682_025040) | 5390778..5391224 | + | 447 | WP_010952399.1 | universal stress protein | - |
| LU682_RS25045 (LU682_025045) | 5391317..5391643 | + | 327 | WP_014859917.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| LU682_RS25050 (LU682_025050) | 5391640..5392107 | + | 468 | WP_010952397.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| LU682_RS25055 (LU682_025055) | 5392180..5393040 | - | 861 | WP_010952396.1 | HlyD family secretion protein | - |
| LU682_RS25060 (LU682_025060) | 5393051..5393251 | - | 201 | WP_003251718.1 | DUF1656 domain-containing protein | - |
| LU682_RS25065 (LU682_025065) | 5393241..5395418 | - | 2178 | WP_003251716.1 | FUSC family protein | - |
| LU682_RS25070 (LU682_025070) | 5395415..5396944 | - | 1530 | WP_010952395.1 | efflux transporter outer membrane subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 17962.34 Da Isoelectric Point: 9.7963
>T284837 WP_010952397.1 NZ_CP128540:5391640-5392107 [Pseudomonas alloputida]
MSDASRKPLVIHGWTVIAHPLFLAKLDALSAQVEAQRDKDPTGYTKRNTFKRLAAIRRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWINDESSKRAYESSDDAYKVFQKMLHSGNPPDDWDQLLQEAAAD
MSDASRKPLVIHGWTVIAHPLFLAKLDALSAQVEAQRDKDPTGYTKRNTFKRLAAIRRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWINDESSKRAYESSDDAYKVFQKMLHSGNPPDDWDQLLQEAAAD
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|