Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5008407..5008993 | Replicon | chromosome |
Accession | NZ_CP128540 | ||
Organism | Pseudomonas alloputida strain NMI24_14 |
Toxin (Protein)
Gene name | graT | Uniprot ID | Q88MI5 |
Locus tag | LU682_RS23225 | Protein ID | WP_010952670.1 |
Coordinates | 5008407..5008685 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | Q88MI6 |
Locus tag | LU682_RS23230 | Protein ID | WP_010952669.1 |
Coordinates | 5008694..5008993 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LU682_RS23215 (LU682_023215) | 5005208..5006404 | + | 1197 | WP_010952672.1 | succinyldiaminopimelate transaminase | - |
LU682_RS23220 (LU682_023220) | 5006510..5008156 | - | 1647 | WP_049587427.1 | Na+/H+ antiporter | - |
LU682_RS23225 (LU682_023225) | 5008407..5008685 | + | 279 | WP_010952670.1 | type II toxin-antitoxin system toxin GraT | Toxin |
LU682_RS23230 (LU682_023230) | 5008694..5008993 | + | 300 | WP_010952669.1 | type II toxin-antitoxin system antitoxin GraA | Antitoxin |
LU682_RS23235 (LU682_023235) | 5009118..5009465 | + | 348 | WP_003252272.1 | ArsC family reductase | - |
LU682_RS23240 (LU682_023240) | 5009497..5010531 | + | 1035 | WP_004574732.1 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | - |
LU682_RS23245 (LU682_023245) | 5010613..5011818 | + | 1206 | WP_010952615.1 | cysteine desulfurase | - |
LU682_RS23250 (LU682_023250) | 5011815..5012225 | + | 411 | WP_003252266.1 | SufE family protein | - |
LU682_RS23255 (LU682_023255) | 5012338..5013147 | - | 810 | WP_162490563.1 | tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10446.72 Da Isoelectric Point: 7.2450
>T284836 WP_010952670.1 NZ_CP128540:5008407-5008685 [Pseudomonas alloputida]
MIRSFSCADTEALFTTGKTRRGSDIKSVAERKLAMLDAATELRDLRSPPGNRLESLSGNRADQHSIRVNDQWRLCFTWTE
HGPVNVEIVDYH
MIRSFSCADTEALFTTGKTRRGSDIKSVAERKLAMLDAATELRDLRSPPGNRLESLSGNRADQHSIRVNDQWRLCFTWTE
HGPVNVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|