Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 1981537..1982237 | Replicon | chromosome |
| Accession | NZ_CP128540 | ||
| Organism | Pseudomonas alloputida strain NMI24_14 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | Q88F93 |
| Locus tag | LU682_RS09080 | Protein ID | WP_010954960.1 |
| Coordinates | 1981537..1981833 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | I7AUJ7 |
| Locus tag | LU682_RS09085 | Protein ID | WP_003254235.1 |
| Coordinates | 1981836..1982237 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU682_RS09060 (LU682_009060) | 1977529..1978707 | - | 1179 | WP_010954964.1 | efflux RND transporter periplasmic adaptor subunit | - |
| LU682_RS09065 (LU682_009065) | 1978920..1979396 | + | 477 | WP_010954963.1 | sigma-70 family RNA polymerase sigma factor | - |
| LU682_RS09070 (LU682_009070) | 1979565..1980044 | + | 480 | WP_010954962.1 | hypothetical protein | - |
| LU682_RS09075 (LU682_009075) | 1980117..1981442 | + | 1326 | WP_010954961.1 | MFS transporter | - |
| LU682_RS09080 (LU682_009080) | 1981537..1981833 | + | 297 | WP_010954960.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
| LU682_RS09085 (LU682_009085) | 1981836..1982237 | + | 402 | WP_003254235.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| LU682_RS09090 (LU682_009090) | 1982309..1983991 | - | 1683 | WP_010954959.1 | electron transfer flavoprotein-ubiquinone oxidoreductase | - |
| LU682_RS09095 (LU682_009095) | 1984527..1985276 | + | 750 | WP_003254232.1 | electron transfer flavoprotein subunit beta/FixA family protein | - |
| LU682_RS09100 (LU682_009100) | 1985277..1986206 | + | 930 | WP_010954958.1 | FAD-binding protein | - |
| LU682_RS09105 (LU682_009105) | 1986282..1987103 | + | 822 | WP_010954957.1 | transporter substrate-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11133.22 Da Isoelectric Point: 10.2271
>T284833 WP_010954960.1 NZ_CP128540:1981537-1981833 [Pseudomonas alloputida]
MEKRMPHCPLERVKALAAARRIRPTGAALKGAKALGMDFPGMLEVITSLKRTDFYKSMTSHIDHRVWQDVYRPLTAIGYV
YLKLSVVDDVLIVSFKEL
MEKRMPHCPLERVKALAAARRIRPTGAALKGAKALGMDFPGMLEVITSLKRTDFYKSMTSHIDHRVWQDVYRPLTAIGYV
YLKLSVVDDVLIVSFKEL
Download Length: 297 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14684.76 Da Isoelectric Point: 4.9531
>AT284833 WP_003254235.1 NZ_CP128540:1981836-1982237 [Pseudomonas alloputida]
MRCPICGGSELAPDIQGMPYSYKGEMTVIPEVSGDYCSACGECVLSHDEAMRVSHLMTAFERQVNANVVDPSFIASIRRK
FDLDQREAGEIFGGGVNAFSRYENGKTTPPVALVKLLKLLDRHPELFEEVRTA
MRCPICGGSELAPDIQGMPYSYKGEMTVIPEVSGDYCSACGECVLSHDEAMRVSHLMTAFERQVNANVVDPSFIASIRRK
FDLDQREAGEIFGGGVNAFSRYENGKTTPPVALVKLLKLLDRHPELFEEVRTA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|