Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 1415106..1415707 | Replicon | chromosome |
| Accession | NZ_CP128540 | ||
| Organism | Pseudomonas alloputida strain NMI24_14 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2L1IAQ2 |
| Locus tag | LU682_RS06365 | Protein ID | WP_049587984.1 |
| Coordinates | 1415393..1415707 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A2L1IAR7 |
| Locus tag | LU682_RS06360 | Protein ID | WP_049587986.1 |
| Coordinates | 1415106..1415393 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU682_RS06340 (LU682_006340) | 1410138..1410983 | + | 846 | WP_003254799.1 | DUF6502 family protein | - |
| LU682_RS06345 (LU682_006345) | 1410980..1412698 | + | 1719 | WP_010952348.1 | DUF5666 domain-containing protein | - |
| LU682_RS06350 (LU682_006350) | 1412753..1413502 | + | 750 | WP_049587988.1 | hypothetical protein | - |
| LU682_RS06355 (LU682_006355) | 1413574..1414905 | - | 1332 | WP_004576169.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| LU682_RS06360 (LU682_006360) | 1415106..1415393 | - | 288 | WP_049587986.1 | helix-turn-helix domain-containing protein | Antitoxin |
| LU682_RS06365 (LU682_006365) | 1415393..1415707 | - | 315 | WP_049587984.1 | hypothetical protein | Toxin |
| LU682_RS06370 (LU682_006370) | 1416156..1418066 | + | 1911 | WP_010952353.1 | potassium transporter Kup | - |
| LU682_RS06375 (LU682_006375) | 1418115..1419407 | - | 1293 | WP_010952354.1 | AcvB/VirJ family lysyl-phosphatidylglycerol hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11784.61 Da Isoelectric Point: 9.9097
>T284832 WP_049587984.1 NZ_CP128540:c1415707-1415393 [Pseudomonas alloputida]
MIFIETPVFTSDLKEHLDDEEYRALQAYLAEHPEAGSLLEETGGLRKIRWAAKGKGKSGGVRVIYYHVTAAHQIRMILIY
RKGIVDTLTSSQKAQLRALNKGWK
MIFIETPVFTSDLKEHLDDEEYRALQAYLAEHPEAGSLLEETGGLRKIRWAAKGKGKSGGVRVIYYHVTAAHQIRMILIY
RKGIVDTLTSSQKAQLRALNKGWK
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2L1IAQ2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2L1IAR7 |